Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FOXA3 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P55318
Molecular weight:
21.95 kDa

Original price was: €247.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Ser121–Glu202
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FOXA3 Protein, N-His-SUMO

Product name ARO-P11313-100
Uniprot ID P55318
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFE
Molecular weight 21.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser121-Glu202
Aliases /Synonyms TCF-3G, TCF3G, Fork head-related protein FKH H3, HNF-3-gamma, HNF-3G, HNF3G, FOXA3, Hepatocyte nuclear factor 3-gamma, Forkhead box protein A3, Transcription factor 3G
Reference ARO-P11313
Note For research use only.
Molecular Constructor
Ser121–Glu202
Product name ARO-P11313-1MG
Uniprot ID P55318
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFE
Molecular weight 21.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser121-Glu202
Aliases /Synonyms TCF-3G, TCF3G, Fork head-related protein FKH H3, HNF-3-gamma, HNF-3G, HNF3G, FOXA3, Hepatocyte nuclear factor 3-gamma, Forkhead box protein A3, Transcription factor 3G
Reference ARO-P11313
Note For research use only.
Molecular Constructor
Ser121–Glu202
Product name ARO-P11313-50
Uniprot ID P55318
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFE
Molecular weight 21.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser121-Glu202
Aliases /Synonyms TCF-3G, TCF3G, Fork head-related protein FKH H3, HNF-3-gamma, HNF-3G, HNF3G, FOXA3, Hepatocyte nuclear factor 3-gamma, Forkhead box protein A3, Transcription factor 3G
Reference ARO-P11313
Note For research use only.
Molecular Constructor
Ser121–Glu202

Introduction

Recombinant human FOXA3 protein (rhFOXA3) is a highly purified and biologically active protein that is produced through recombinant DNA technology. This protein belongs to the forkhead box (FOX) family of transcription factors, which play crucial roles in regulating gene expression and cellular differentiation. rhFOXA3 has been extensively studied and has shown great potential in various biomedical applications.

Structure of rhFOXA3

rhFOXA3 is a 341 amino acid protein with a molecular weight of approximately 37 kDa. It contains a highly conserved DNA-binding domain, known as the forkhead domain, which is responsible for its transcription factor activity. This domain is composed of three α-helices and two β-sheets, and is essential for binding to specific DNA sequences. In addition, rhFOXA3 also has a transactivation domain, which is responsible for activating gene expression.

Activity of rhFOXA3

rhFOXA3 is a key regulator of gene expression in various biological processes, including embryonic development, metabolism, and immune response. It binds to specific DNA sequences, known as FOXA3 binding sites, and acts as a transcription factor to either activate or repress gene expression. In addition, rhFOXA3 has been shown to interact with other transcription factors and co-regulators, further modulating its activity.

One of the most important functions of rhFOXA3 is its role in embryonic development. It is essential for the formation of the endoderm, which gives rise to various organs such as the liver, pancreas, and lungs. Studies have also shown that rhFOXA3 is involved in regulating glucose and lipid metabolism, making it a potential target for treating metabolic disorders such as diabetes and obesity.

Furthermore, rhFOXA3 has been shown to play a crucial role in immune response. It has been found to regulate the expression of genes involved in inflammation and immune cell differentiation. In addition, rhFOXA3 has been linked to various diseases, such as asthma, inflammatory bowel disease, and cancer, highlighting its importance in immune-related disorders.

Application of rhFOXA3

Given its diverse functions and potential therapeutic applications, rhFOXA3 has been extensively studied and has shown promising results in various biomedical fields. One of the main applications of rhFOXA3 is in regenerative medicine. Its role in embryonic development and tissue differentiation makes it a potential candidate for promoting tissue repair and regeneration. Studies have shown that rhFOXA3 can stimulate the differentiation of stem cells into endoderm-like cells, which can then be further differentiated into specific cell types.

In addition, rhFOXA3 has been used in drug discovery and development. Its involvement in various diseases, such as diabetes and cancer, makes it a potential target for developing new treatments. Researchers have used rhFOXA3 as a tool to identify potential drug candidates and to study their effects on gene expression and cellular processes.

Another potential application of rhFOXA3 is in diagnostics. As a transcription factor, rhFOXA3 can regulate the expression of specific genes, making it a potential biomarker for certain diseases. Studies have shown that changes in rhFOXA3 expression levels are associated with various diseases, such as liver cancer and asthma, making it a potential diagnostic marker.

Conclusion

In summary, rhFOXA3 is a highly purified and biologically active protein that plays crucial roles in regulating gene expression and cellular differentiation. Its structure, activity, and potential applications make it a valuable tool in various biomedical fields. Further research on rhFOXA3 and its interactions with other molecules may lead to new insights and potential therapeutic interventions for various diseases.

Recombinant Human FOXA3 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human FOXA3 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products