Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FGF16 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O43320
Molecular weight:
22.57 kDa

Original price was: €285.00.Current price is: €230.00.

50ug 19% OFF + 230 loyalty points
Asn35–Arg207
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FGF16 Protein, N-His

Product name ARO-P11540-100
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 22.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P11540
Note For research use only.
Molecular Constructor
Asn35–Arg207
Product name ARO-P11540-1MG
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 22.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P11540
Note For research use only.
Molecular Constructor
Asn35–Arg207
Product name ARO-P11540-50
Uniprot ID O43320
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Molecular weight 22.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn35-Arg207
Aliases /Synonyms FGF-16, Fibroblast growth factor 16, FGF16
Reference ARO-P11540
Note For research use only.
Molecular Constructor
Asn35–Arg207

Introduction to Recombinant Human FGF16 Protein

Recombinant Human FGF16 Protein, also known as Fibroblast Growth Factor 16, is a member of the fibroblast growth factor (FGF) family. This protein is involved in various cellular processes such as cell growth, differentiation, and migration. It is produced through genetic engineering techniques, making it a highly purified and specific protein with numerous applications in the field of biotechnology and medicine.

Structure of Recombinant Human FGF16 Protein

The Recombinant Human FGF16 Protein is composed of 207 amino acids and has a molecular weight of approximately 23 kDa. It contains a highly conserved core region of 120 amino acids, which is responsible for its biological activity. This core region is surrounded by a flexible N-terminal region and a C-terminal tail that varies in length among different FGF family members.

The structure of Recombinant Human FGF16 Protein is characterized by the presence of 12 beta strands and 4 alpha helices, forming a compact and globular protein. It also contains a heparin-binding domain, which is essential for its interaction with cell surface receptors.

Activity of Recombinant Human FGF16 Protein

Recombinant Human FGF16 Protein is a potent mitogen, meaning it stimulates cell proliferation. It exerts its biological activity by binding to specific cell surface receptors, known as FGF receptors (FGFRs). Upon binding, FGF16 activates the FGFRs, which triggers a cascade of signaling pathways, leading to cell growth, differentiation, and migration.

One of the unique characteristics of Recombinant Human FGF16 Protein is its ability to bind to multiple FGFRs, including FGFR1, FGFR2, and FGFR3. This allows it to exert its effects on various cell types, making it a versatile protein with a wide range of applications.

Applications of Recombinant Human FGF16 Protein

Stem Cell Research

Recombinant Human FGF16 Protein has been widely used in stem cell research due to its ability to promote cell proliferation and differentiation. It has been shown to enhance the growth of embryonic stem cells and induce the differentiation of mesenchymal stem cells into bone and cartilage cells.

Tissue Engineering

Recombinant Human FGF16 Protein has also been utilized in tissue engineering applications. Its mitogenic and differentiation-inducing properties make it a valuable tool for promoting the growth and differentiation of cells in engineered tissues. It has been used to enhance the regeneration of bone, cartilage, and nerve tissues.

Cancer Research

Aberrant expression of FGF16 has been associated with various types of cancer, making Recombinant Human FGF16 Protein a potential target for cancer therapy. It has been shown to inhibit the growth of cancer cells and induce their death, making it a promising candidate for the development of anti-cancer drugs.

Wound Healing

Recombinant Human FGF16 Protein has been demonstrated to play a crucial role in wound healing. It promotes the proliferation and migration of skin cells, leading to faster wound closure and improved tissue regeneration. This makes it a potential therapeutic agent for treating chronic wounds and promoting tissue repair.

Diagnostic Applications

Due to its ability to bind to multiple FGFRs, Recombinant Human FGF16 Protein has been used as an antigen in diagnostic assays for various diseases. It has been shown to be a potential biomarker for certain cancers and has been used in immunoassays to detect the presence of FGF16 in patient samples.

Conclusion

In summary, Recombinant Human FGF16 Protein is a highly purified and specific protein with various structural and

Recombinant Human FGF16 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FGF16 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products