Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ERAP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NZ08
Molecular weight:
50.12 kDa

Original price was: €352.00.Current price is: €275.00.

100ug 22% OFF + 275 loyalty points
Gly529–Met941
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ERAP1 Protein, N-His

Product name ARO-P11788-100
Uniprot ID Q9NZ08
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GFPLITITVRGRNVHMKQEHYMKGSDGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKFNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTEGWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
Molecular weight 50.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly529-Met941
Aliases /Synonyms Aminopeptidase PILS, ARTS1, Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator, PILS-AP, Endoplasmic reticulum aminopeptidase 1, ARTS-1, A-LAP, Puromycin-insensitive leucyl-specific aminopeptidase, APPILS, ERAP1, KIAA0525, Adipocyte-derived leucine aminopeptidase
Reference ARO-P11788
Note For research use only.
Molecular Constructor
Gly529–Met941
Product name ARO-P11788-1MG
Uniprot ID Q9NZ08
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GFPLITITVRGRNVHMKQEHYMKGSDGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKFNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTEGWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
Molecular weight 50.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly529-Met941
Aliases /Synonyms Aminopeptidase PILS, ARTS1, Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator, PILS-AP, Endoplasmic reticulum aminopeptidase 1, ARTS-1, A-LAP, Puromycin-insensitive leucyl-specific aminopeptidase, APPILS, ERAP1, KIAA0525, Adipocyte-derived leucine aminopeptidase
Reference ARO-P11788
Note For research use only.
Molecular Constructor
Gly529–Met941
Product name ARO-P11788-50
Uniprot ID Q9NZ08
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GFPLITITVRGRNVHMKQEHYMKGSDGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKFNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDLSLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTEGWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM
Molecular weight 50.12 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly529-Met941
Aliases /Synonyms Aminopeptidase PILS, ARTS1, Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator, PILS-AP, Endoplasmic reticulum aminopeptidase 1, ARTS-1, A-LAP, Puromycin-insensitive leucyl-specific aminopeptidase, APPILS, ERAP1, KIAA0525, Adipocyte-derived leucine aminopeptidase
Reference ARO-P11788
Note For research use only.
Molecular Constructor
Gly529–Met941

Introduction

Recombinant Human ERAP1 protein is a highly active enzyme that plays a crucial role in the processing and presentation of peptide antigens in the immune system. This protein is a member of the aminopeptidase family and is encoded by the ERAP1 gene. It is produced through recombinant DNA technology, making it a valuable tool in various scientific research and medical applications.

Structure of Recombinant Human ERAP1 Protein

The recombinant form of ERAP1 protein is a 94 kDa homodimer with each subunit consisting of 963 amino acids. It has a modular structure, with an N-terminal catalytic domain and a C-terminal non-catalytic domain. The catalytic domain contains the active site responsible for the protein’s enzymatic activity, while the non-catalytic domain is involved in substrate binding and regulation of enzyme activity.

Activity of Recombinant Human ERAP1 Protein

The main function of ERAP1 protein is to trim and process peptides for presentation on major histocompatibility complex (MHC) class I molecules. This process is essential for the activation of CD8+ T cells, which play a crucial role in the adaptive immune response. ERAP1 protein acts as an aminopeptidase, cleaving amino acids from the N-terminus of peptides to generate shorter and more antigenic peptides that can bind to MHC class I molecules.

Additionally, ERAP1 protein has been shown to have a role in the regulation of inflammatory responses. It can modulate the activity of cytokines and chemokines, which are involved in the recruitment and activation of immune cells. This activity of ERAP1 protein makes it a potential target for therapeutic interventions in inflammatory diseases.

Application of Recombinant Human ERAP1 Protein

Recombinant Human ERAP1 protein has a wide range of applications in both basic research and clinical settings. Its ability to process and present peptides makes it a valuable tool in studying the immune response and the role of MHC class I molecules in antigen presentation. It has also been used in vaccine development, as it can enhance the immunogenicity of peptide antigens by generating more efficient MHC class I binding peptides.

In addition, the role of ERAP1 protein in inflammatory diseases has led to its potential use as a therapeutic target. Studies have shown that modulating ERAP1 activity can alter the expression of cytokines and chemokines, making it a potential treatment for conditions such as rheumatoid arthritis and psoriasis.

Furthermore, recombinant ERAP1 protein has been used in diagnostic assays for various diseases, including autoimmune disorders and cancer. Its ability to process and present antigens makes it a valuable tool for detecting and monitoring immune responses in these conditions.

Conclusion

In summary, recombinant Human ERAP1 protein is a highly active enzyme with a crucial role in the processing and presentation of peptide antigens in the immune system. Its modular structure, enzymatic activity, and diverse applications make it a valuable tool in various scientific and medical fields. Further research on this protein may lead to a better understanding of immune responses and the development of novel therapeutic interventions.

Recombinant Human ERAP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ERAP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products