Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EIF2D Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P41214
Molecular weight:
17.25 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Lys45–Lys182
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EIF2D Protein, N-His

Product name ARO-P12341-100
Uniprot ID P41214
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KEELNIVKLYAHKGDAVTVYVSGGNPILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMPPAGLPQVQKGDLCAISLVGNRAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNK
Molecular weight 17.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys45-Lys182
Aliases /Synonyms LGTN, Ligatin, HCA56, Hepatocellular carcinoma-associated antigen 56, Eukaryotic translation initiation factor 2D, eIF2d, EIF2D
Reference ARO-P12341
Note For research use only.
Molecular Constructor
Lys45–Lys182
Product name ARO-P12341-1MG
Uniprot ID P41214
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KEELNIVKLYAHKGDAVTVYVSGGNPILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMPPAGLPQVQKGDLCAISLVGNRAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNK
Molecular weight 17.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys45-Lys182
Aliases /Synonyms LGTN, Ligatin, HCA56, Hepatocellular carcinoma-associated antigen 56, Eukaryotic translation initiation factor 2D, eIF2d, EIF2D
Reference ARO-P12341
Note For research use only.
Molecular Constructor
Lys45–Lys182
Product name ARO-P12341-50
Uniprot ID P41214
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KEELNIVKLYAHKGDAVTVYVSGGNPILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMPPAGLPQVQKGDLCAISLVGNRAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNK
Molecular weight 17.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys45-Lys182
Aliases /Synonyms LGTN, Ligatin, HCA56, Hepatocellular carcinoma-associated antigen 56, Eukaryotic translation initiation factor 2D, eIF2d, EIF2D
Reference ARO-P12341
Note For research use only.
Molecular Constructor
Lys45–Lys182

Recombinant Human EIF2D Protein: Structure, Activity, and Applications

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the gene for a specific protein is inserted into a host organism to produce large quantities of the desired protein. One such recombinant protein is the Recombinant Human EIF2D Protein, which has gained significant attention in the field of biotechnology due to its unique structure, diverse activity, and wide range of applications.

Structure of Recombinant Human EIF2D Protein

The Recombinant Human EIF2D Protein, also known as Eukaryotic Translation Initiation Factor 2D, is a 20-kDa protein that is composed of 180 amino acids. It is a member of the eukaryotic translation initiation factor 2 (eIF2) family, which plays a crucial role in the initiation of protein synthesis in eukaryotic cells. The protein has a conserved N-terminal domain and a C-terminal domain that is rich in arginine and serine residues.

The three-dimensional structure of Recombinant Human EIF2D Protein has been determined through X-ray crystallography, revealing a unique fold with a central beta-sheet surrounded by alpha-helices. This unique structure is essential for the protein’s function and allows it to interact with other proteins and molecules in the cell.

Activity of Recombinant Human EIF2D Protein

The primary function of Recombinant Human EIF2D Protein is to regulate the initiation of protein synthesis in eukaryotic cells. It does this by binding to the eIF2 complex, which is responsible for delivering the initiator methionine-tRNA to the ribosome. This binding leads to the inhibition of protein synthesis, which is essential for cellular stress responses and the control of gene expression.

In addition to its role in protein synthesis, Recombinant Human EIF2D Protein has also been found to play a role in cell survival and apoptosis. It has been shown to interact with other proteins involved in these processes, such as Bcl-2 and p53, and modulate their activity. This highlights the diverse activity of this protein and its potential as a therapeutic target for various diseases.

Applications of Recombinant Human EIF2D Protein

The unique structure and diverse activity of Recombinant Human EIF2D Protein make it a valuable tool for various applications in biotechnology and medicine. One of the primary applications of this protein is in the production of recombinant proteins for research and therapeutic purposes. Its ability to inhibit protein synthesis makes it an ideal tool for controlling the expression of recombinant proteins in host cells.

In addition, Recombinant Human EIF2D Protein has been studied as a potential target for cancer therapy. The protein’s role in cell survival and apoptosis makes it a promising target for the development of novel anti-cancer drugs. Furthermore, its interaction with other proteins involved in cancer pathways makes it a potential biomarker for cancer diagnosis and prognosis.

Other potential applications of Recombinant Human EIF2D Protein include its use as a vaccine antigen for infectious diseases and as a tool for studying cellular stress responses and gene expression regulation.

Conclusion

In summary, Recombinant Human EIF2D Protein is a unique and versatile protein with a diverse range of activities and applications. Its structure and function make it a valuable tool in biotechnology and a potential target for various diseases. Further research on this protein will undoubtedly uncover more of its potential and contribute to the development of new and innovative technologies and treatments.

Recombinant Human EIF2D Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EIF2D Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products