Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PIK3R5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8WYR1
Molecular weight:
21.29 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Ala666–Cys838
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PIK3R5 Protein, N-His

Product name ARO-P11841-100
Uniprot ID Q8WYR1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPC
Molecular weight 21.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala666-Cys838
Aliases /Synonyms PIK3R5, Phosphatidylinositol 4,5-bisphosphate 3-kinase regulatory subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, Phosphoinositide 3-kinase regulatory subunit 5, PtdIns-3-kinase p101, p101-PI3K, Protein FOAP-2, PI3-kinase p101 subunit
Reference ARO-P11841
Note For research use only.
Molecular Constructor
Ala666–Cys838
Product name ARO-P11841-1MG
Uniprot ID Q8WYR1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPC
Molecular weight 21.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala666-Cys838
Aliases /Synonyms PIK3R5, Phosphatidylinositol 4,5-bisphosphate 3-kinase regulatory subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, Phosphoinositide 3-kinase regulatory subunit 5, PtdIns-3-kinase p101, p101-PI3K, Protein FOAP-2, PI3-kinase p101 subunit
Reference ARO-P11841
Note For research use only.
Molecular Constructor
Ala666–Cys838
Product name ARO-P11841-50
Uniprot ID Q8WYR1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPC
Molecular weight 21.29 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala666-Cys838
Aliases /Synonyms PIK3R5, Phosphatidylinositol 4,5-bisphosphate 3-kinase regulatory subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, Phosphoinositide 3-kinase regulatory subunit 5, PtdIns-3-kinase p101, p101-PI3K, Protein FOAP-2, PI3-kinase p101 subunit
Reference ARO-P11841
Note For research use only.
Molecular Constructor
Ala666–Cys838

Structure of Recombinant Human PIK3R5 Protein

Recombinant Human PIK3R5 Protein, also known as Phosphoinositide-3-Kinase Regulatory Subunit 5, is a protein that is encoded by the PIK3R5 gene. It is a member of the phosphoinositide-3-kinase (PI3K) family, which plays a crucial role in cell signaling and regulation of various cellular processes. The protein is composed of 610 amino acids and has a molecular weight of approximately 70 kDa.

The primary structure of Recombinant Human PIK3R5 Protein includes an N-terminal SH2 domain, two proline-rich regions, and a C-terminal domain. The SH2 domain is responsible for binding to phosphorylated tyrosine residues on other proteins, thereby regulating the activity of PI3K. The proline-rich regions are involved in protein-protein interactions, while the C-terminal domain is important for the recruitment of the PI3K catalytic subunits.

In terms of secondary structure, Recombinant Human PIK3R5 Protein is predominantly composed of alpha-helices and beta-strands. The SH2 domain contains a three-stranded beta-sheet and two alpha-helices, while the C-terminal domain consists of a five-stranded beta-sheet and several alpha-helices. These structural elements are essential for the proper functioning of the protein.

Activity of Recombinant Human PIK3R5 Protein

Recombinant Human PIK3R5 Protein is a regulatory subunit of PI3K, which is an enzyme that catalyzes the phosphorylation of phosphatidylinositol lipids. This process results in the production of second messenger molecules that play a crucial role in various cellular processes, including cell growth, survival, and metabolism.

The activity of Recombinant Human PIK3R5 Protein is tightly regulated by various mechanisms. One of the key regulators is the binding of the SH2 domain to phosphorylated tyrosine residues on other proteins. This interaction leads to the activation of PI3K and subsequent downstream signaling events.

Moreover, Recombinant Human PIK3R5 Protein has been shown to play a role in the regulation of immune responses. It has been reported that the protein is involved in the activation of T cells and the production of pro-inflammatory cytokines. It also plays a role in the activation of B cells and the production of antibodies.

Application of Recombinant Human PIK3R5 Protein

Recombinant Human PIK3R5 Protein has a wide range of applications in both basic research and clinical settings. In basic research, the protein is used to study the signaling pathways involved in various cellular processes. It is also used to investigate the role of PI3K in diseases such as cancer, diabetes, and autoimmune disorders.

In a clinical setting, Recombinant Human PIK3R5 Protein has potential therapeutic applications. As PI3K is often dysregulated in cancer, targeting this pathway with PI3K inhibitors, including Recombinant Human PIK3R5 Protein, has shown promising results in pre-clinical studies. Additionally, the protein has been studied for its potential use in the treatment of autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis.

In conclusion, Recombinant Human PIK3R5 Protein is a crucial component of the PI3K signaling pathway, and its structure and activity play a vital role in regulating various cellular processes. Its potential therapeutic applications make it a valuable tool for both basic research and clinical studies.

Recombinant Human PIK3R5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PIK3R5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products