Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EHBP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8NDI1
Molecular weight:
14.55 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Met1–Asn104
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EHBP1 Protein, N-His

Product name ARO-P12066-100
Uniprot ID Q8NDI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIEN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn104
Aliases /Synonyms EH domain-binding protein 1, KIAA0903, NACSIN, EHBP1
Reference ARO-P12066
Note For research use only.
Molecular Constructor
Met1–Asn104
Product name ARO-P12066-1MG
Uniprot ID Q8NDI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIEN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn104
Aliases /Synonyms EH domain-binding protein 1, KIAA0903, NACSIN, EHBP1
Reference ARO-P12066
Note For research use only.
Molecular Constructor
Met1–Asn104
Product name ARO-P12066-50
Uniprot ID Q8NDI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MASVWKRLQRVGKHASKFQFVASYQELMVECTKKWQPDKLVVVWTRRSRRKSSKAHSWQPGIKNPYRGVVVWPVPENIEITVTLFKDPHAEEFEDKEWTFVIEN
Molecular weight 14.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn104
Aliases /Synonyms EH domain-binding protein 1, KIAA0903, NACSIN, EHBP1
Reference ARO-P12066
Note For research use only.
Molecular Constructor
Met1–Asn104

Introduction

Recombinant Human EHBP1 Protein is a type of protein that is produced through genetic engineering techniques. It is a highly purified and bioactive protein that has a wide range of applications in the field of biotechnology and medicine. In this article, we will explore the structure, activity, and applications of Recombinant Human EHBP1 Protein in detail.

Structure of Recombinant Human EHBP1 Protein

Recombinant Human EHBP1 Protein is a 170 kDa protein that is composed of 1488 amino acids. It is a member of the EH domain-containing protein family and is highly conserved among different species. The protein is composed of multiple domains, including an N-terminal EH domain, a central coiled-coil domain, and a C-terminal proline-rich domain. These domains are important for the protein’s function and interaction with other molecules.

EH Domain

The EH domain is responsible for the protein’s binding to other proteins and is involved in protein-protein interactions. It is composed of three alpha-helices and a beta-sheet, and it forms a compact structure. The EH domain of Recombinant Human EHBP1 Protein has been shown to interact with proteins involved in endocytosis and intracellular trafficking.

Coiled-coil Domain

The coiled-coil domain is a long, rod-like structure that is formed by two or more alpha-helices coiled around each other. This domain is involved in protein-protein interactions and is important for the stability and function of Recombinant Human EHBP1 Protein. It has been shown to interact with proteins involved in vesicle trafficking and cytoskeletal organization.

Proline-rich Domain

The proline-rich domain of Recombinant Human EHBP1 Protein is composed of multiple proline residues and is involved in protein-protein interactions. It has been shown to interact with proteins involved in cell signaling and cytoskeletal organization.

Activity of Recombinant Human EHBP1 Protein

Recombinant Human EHBP1 Protein has been shown to have multiple activities in different cellular processes. It is primarily involved in endocytosis and intracellular trafficking, and it plays a crucial role in maintaining the balance of cellular components. The protein has been shown to interact with various proteins involved in these processes, including Eps15, Epsin, and EHD1.

Moreover, Recombinant Human EHBP1 Protein has been shown to play a role in cell signaling by interacting with proteins involved in the regulation of cell growth and proliferation. It has also been shown to regulate the activity of Rho GTPases, which are important for cell migration and adhesion.

Applications of Recombinant Human EHBP1 Protein

Recombinant Human EHBP1 Protein has a wide range of applications in the field of biotechnology and medicine. Its ability to interact with various proteins involved in endocytosis and intracellular trafficking makes it a valuable tool for studying these processes. It can also be used to study the role of Rho GTPases in cell signaling and cell migration.

Moreover, Recombinant Human EHBP1 Protein has potential therapeutic applications. It has been shown to have anti-tumor activity and can inhibit the growth and proliferation of cancer cells. It has also been shown to play a role in the development of neurological disorders, making it a potential target for drug development.

Antigen Detection

Recombinant Human EHBP1 Protein can also be used as an antigen for detection in diagnostic assays. Its highly specific interactions with other proteins make it a valuable tool for detecting the presence of specific antibodies in patient samples. This can be useful in the diagnosis of autoimmune diseases and infectious diseases.

Drug Targeting

The specific interactions of Recombinant Human EHBP1 Protein with other proteins make it a potential drug target. By targeting this protein, it is possible to modulate its activity and potentially treat diseases that involve dysregulation

Recombinant Human EHBP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human EHBP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products