Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human EEA1 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15075
Molecular weight:
23.27 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Ala1325–Gly1411
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human EEA1 Protein, N-His-SUMO & C-Strep

Product name ARO-P11219-100
Uniprot ID Q15075
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Molecular weight 23.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1325-Gly1411
Aliases /Synonyms EEA1, Endosome-associated protein p162, Zinc finger FYVE domain-containing protein 2, ZFYVE2, Early endosome antigen 1
Reference ARO-P11219
Note For research use only.
Molecular Constructor
Ala1325–Gly1411
Product name ARO-P11219-1MG
Uniprot ID Q15075
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Molecular weight 23.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1325-Gly1411
Aliases /Synonyms EEA1, Endosome-associated protein p162, Zinc finger FYVE domain-containing protein 2, ZFYVE2, Early endosome antigen 1
Reference ARO-P11219
Note For research use only.
Molecular Constructor
Ala1325–Gly1411
Product name ARO-P11219-50
Uniprot ID Q15075
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Molecular weight 23.27 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala1325-Gly1411
Aliases /Synonyms EEA1, Endosome-associated protein p162, Zinc finger FYVE domain-containing protein 2, ZFYVE2, Early endosome antigen 1
Reference ARO-P11219
Note For research use only.
Molecular Constructor
Ala1325–Gly1411

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the gene for a specific protein is inserted into a host organism, such as bacteria or yeast, to produce large quantities of the protein. These proteins have a wide range of applications in various fields, including medicine, biotechnology, and research. One such protein is the Recombinant Human EEA1 Protein, which has gained significant attention due to its unique structure, activity, and potential applications.

Structure of Recombinant Human EEA1 Protein

The Recombinant Human EEA1 Protein is a 162 kDa protein that belongs to the Early Endosome Antigen 1 (EEA1) family. It is a cytosolic protein that is involved in the regulation of endosome dynamics and membrane trafficking. The protein is composed of 1366 amino acids and contains several functional domains, including a Rab5-binding domain, a FYVE domain, and a coiled-coil domain. These domains play a crucial role in the protein’s activity and function.

Activity of Recombinant Human EEA1 Protein

The primary function of Recombinant Human EEA1 Protein is to regulate endosome dynamics and membrane trafficking. It is a key component of the endosome fusion machinery and is responsible for the fusion of early endosomes with late endosomes. This process is essential for the sorting and delivery of cargo molecules to their respective destinations within the cell. The Rab5-binding domain of the protein allows it to interact with the small GTPase protein Rab5, which is involved in the formation and maturation of early endosomes.

In addition to its role in endosome dynamics, Recombinant Human EEA1 Protein also plays a crucial role in autophagy, a cellular process that involves the degradation of damaged or unnecessary cellular components. The protein interacts with several autophagy-related proteins, including LC3 and ATG12, to regulate the formation and maturation of autophagosomes.

Applications of Recombinant Human EEA1 Protein

Due to its unique structure and activity, Recombinant Human EEA1 Protein has a wide range of potential applications. One of the most significant applications is in the study of endosome dynamics and membrane trafficking. The protein can be used in in vitro and in vivo experiments to understand the mechanisms involved in these processes and their regulation. It can also be used to study the role of early endosomes in various cellular processes, such as cell signaling and nutrient uptake.

Recombinant Human EEA1 Protein also has potential applications in drug discovery and development. As it is involved in the regulation of autophagy, the protein can be targeted for the development of novel therapeutics for diseases that involve dysregulation of this process, such as cancer and neurodegenerative disorders.

Furthermore, the protein has diagnostic applications as well. Its interaction with Rab5 and other proteins can be used as a biomarker for certain diseases, providing a potential diagnostic tool for early detection and treatment.

Conclusion

In summary, Recombinant Human EEA1 Protein is a unique and versatile protein with a crucial role in endosome dynamics, autophagy, and other cellular processes. Its structure and activity make it a valuable tool for studying these processes and their regulation, as well as for potential applications in drug discovery and diagnostics. With ongoing research and advancements in genetic engineering techniques, the potential for this protein in various fields is vast, and it will continue to be a subject of interest and investigation in the scientific community.

Recombinant Human EEA1 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human EEA1 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products