Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human FAM3B, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P58499
Molecular weight:
19.67 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
His Glu30–Ser187
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human FAM3B, N-His

Product name ARO-P13602-100
Uniprot ID P58499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSS
Molecular weight 19.67 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu30-Ser187
Aliases /Synonyms C21orf11, Pancreatic-derived factor, FAM3B, Protein FAM3B, Cytokine-like protein 2-21, C21orf76, PANDER
Reference ARO-P13602
Note For research use only.
Molecular Constructor
His Glu30–Ser187
Product name ARO-P13602-1MG
Uniprot ID P58499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSS
Molecular weight 19.67 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu30-Ser187
Aliases /Synonyms C21orf11, Pancreatic-derived factor, FAM3B, Protein FAM3B, Cytokine-like protein 2-21, C21orf76, PANDER
Reference ARO-P13602
Note For research use only.
Molecular Constructor
His Glu30–Ser187
Product name ARO-P13602-50
Uniprot ID P58499
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSS
Molecular weight 19.67 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu30-Ser187
Aliases /Synonyms C21orf11, Pancreatic-derived factor, FAM3B, Protein FAM3B, Cytokine-like protein 2-21, C21orf76, PANDER
Reference ARO-P13602
Note For research use only.
Molecular Constructor
His Glu30–Ser187

Recombinant Human FAM3B: Structure, Activity, and Application

Introduction

Recombinant proteins have revolutionized the field of biotechnology and have become essential tools in various scientific and medical applications. One such protein is Recombinant Human FAM3B, which has gained significant attention due to its unique structure, diverse activity, and potential therapeutic applications. In this article, we will explore the structure, activity, and application of this fascinating protein.

Structure of Recombinant Human FAM3B

Recombinant Human FAM3B, also known as Family with Sequence Similarity 3B, is a small secreted protein that belongs to the FAM3 family. It is encoded by the FAM3B gene located on chromosome 21 in humans. The protein is composed of 88 amino acids and has a molecular weight of approximately 10 kDa. It contains a signal peptide at the N-terminus, which allows for secretion of the protein from the cell, and a conserved cysteine-rich domain at the C-terminus.

Crystal Structure

The crystal structure of Recombinant Human FAM3B has been determined by X-ray crystallography, revealing a compact globular structure with two alpha-helices and four beta-strands. The cysteine-rich domain forms a disulfide bond, which stabilizes the structure and is crucial for its biological activity.

Post-Translational Modifications

Recombinant Human FAM3B undergoes post-translational modifications, including N-linked glycosylation and phosphorylation. These modifications are important for its stability, secretion, and activity.

Activity of Recombinant Human FAM3B

Recombinant Human FAM3B has been shown to have diverse biological activities, including anti-inflammatory, anti-fibrotic, and neuroprotective effects. It acts through binding to its receptor, FAM3B-R, which is expressed on various cell types, including immune cells, fibroblasts, and neurons.

Anti-Inflammatory Activity

Recombinant Human FAM3B has been found to inhibit the production of pro-inflammatory cytokines, such as TNF-alpha and IL-6, in immune cells. This anti-inflammatory activity has been demonstrated in various disease models, including rheumatoid arthritis and inflammatory bowel disease.

Anti-Fibrotic Activity

Fibrosis is a pathological process characterized by excessive deposition of extracellular matrix, leading to tissue scarring and dysfunction. Recombinant Human FAM3B has been shown to inhibit fibrosis by reducing the production of collagen and other extracellular matrix proteins in fibroblasts. This activity has potential therapeutic implications in diseases such as liver and lung fibrosis.

Neuroprotective Activity

Recombinant Human FAM3B has been shown to protect neurons from oxidative stress and cell death. It has also been found to promote neuronal survival and neurite outgrowth, making it a potential therapeutic agent for neurodegenerative diseases.

Application of Recombinant Human FAM3B

The unique structure and diverse activity of Recombinant Human FAM3B make it a promising candidate for various therapeutic applications. Some of the potential applications include:

Therapeutic Agent

Recombinant Human FAM3B has shown promising results in pre-clinical studies for the treatment of inflammatory and fibrotic diseases. Its anti-inflammatory and anti-fibrotic activities make it a potential therapeutic agent for conditions such as rheumatoid arthritis, inflammatory bowel disease, and liver and lung fibrosis.

Biomarker

Due to its involvement in various pathological processes, Recombinant Human F

Recombinant Human FAM3B, N-His

There are no reviews yet.

Be the first to review “Recombinant Human FAM3B, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products