Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DTX4 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y2E6
Molecular weight:
28.03 kDa

Original price was: €241.00.Current price is: €193.00.

50ug 20% OFF + 193 loyalty points
Gly387–Asp619
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DTX4 Protein, N-His

Product name ARO-P12068-100
Uniprot ID Q9Y2E6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD
Molecular weight 28.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly387-Asp619
Aliases /Synonyms RING finger protein 155, Protein deltex-4, RNF155, KIAA0937, RING-type E3 ubiquitin transferase DTX4, E3 ubiquitin-protein ligase DTX4, DTX4, Deltex4
Reference ARO-P12068
Note For research use only.
Molecular Constructor
Gly387–Asp619
Product name ARO-P12068-1MG
Uniprot ID Q9Y2E6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD
Molecular weight 28.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly387-Asp619
Aliases /Synonyms RING finger protein 155, Protein deltex-4, RNF155, KIAA0937, RING-type E3 ubiquitin transferase DTX4, E3 ubiquitin-protein ligase DTX4, DTX4, Deltex4
Reference ARO-P12068
Note For research use only.
Molecular Constructor
Gly387–Asp619
Product name ARO-P12068-50
Uniprot ID Q9Y2E6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKTPEEVLKKYLQKVRHPPDEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHVYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTAQEKD
Molecular weight 28.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly387-Asp619
Aliases /Synonyms RING finger protein 155, Protein deltex-4, RNF155, KIAA0937, RING-type E3 ubiquitin transferase DTX4, E3 ubiquitin-protein ligase DTX4, DTX4, Deltex4
Reference ARO-P12068
Note For research use only.
Molecular Constructor
Gly387–Asp619

Introduction to Recombinant Human DTX4 Protein

Recombinant Human DTX4 Protein is a genetically engineered protein produced in a laboratory setting through recombinant DNA technology. This protein is derived from the human DTX4 gene and is widely used in various scientific and medical applications. In this article, we will explore the structure, activity, and potential applications of Recombinant Human DTX4 Protein.

Structure of Recombinant Human DTX4 Protein

The DTX4 gene encodes for a protein known as deltex-4, which belongs to the deltex family of proteins. These proteins play a crucial role in various cellular processes, including protein degradation, cell signaling, and immune response. Recombinant Human DTX4 Protein is a 462 amino acid long protein with a molecular weight of approximately 52 kDa. It contains a RING finger domain, a WWE domain, and a C-terminal region, which are essential for its activity.

Recombinant Human DTX4 Protein is typically produced in bacterial or mammalian cells, using a plasmid vector containing the DTX4 gene. The protein is then purified and characterized to ensure its structural integrity and functionality.

Activity of Recombinant Human DTX4 Protein

Recombinant Human DTX4 Protein is a crucial component of the Notch signaling pathway, which plays a critical role in cell fate determination, proliferation, and differentiation. It acts as a ubiquitin ligase, facilitating the degradation of target proteins involved in the Notch signaling pathway. This process is essential for the proper functioning of the pathway and is crucial for various cellular processes, including development, tissue homeostasis, and immune response.

In addition to its role in the Notch signaling pathway, Recombinant Human DTX4 Protein has been shown to interact with other proteins involved in cell signaling, such as SMAD3 and SMAD4. This interaction is essential for the activation of the TGF-β signaling pathway, which plays a crucial role in cell growth, differentiation, and immune response.

Applications of Recombinant Human DTX4 Protein

Recombinant Human DTX4 Protein has a wide range of potential applications in both scientific research and medical fields. Its role in the Notch signaling pathway makes it a valuable tool for studying the development and function of various tissues and organs. It has also been implicated in various diseases, such as cancer, making it a potential target for therapeutic interventions.

In the medical field, Recombinant Human DTX4 Protein has been used in diagnostic tests for various diseases, such as leukemia and lymphoma. Its ability to interact with specific proteins involved in cell signaling makes it a valuable tool for detecting abnormalities in these pathways, which may be indicative of certain diseases.

Moreover, Recombinant Human DTX4 Protein has also been studied for its potential as a therapeutic agent. Its role in the Notch signaling pathway and its interaction with other proteins make it a potential target for drug development. By modulating the activity of Recombinant Human DTX4 Protein, it may be possible to regulate the Notch signaling pathway and potentially treat diseases associated with its dysregulation.

Conclusion

In summary, Recombinant Human DTX4 Protein is a genetically engineered protein with a crucial role in the Notch signaling pathway. Its structure, activity, and potential applications make it a valuable tool for scientific research and medical applications. Further studies on this protein may provide a better understanding of its role in various cellular processes and its potential as a therapeutic target.

Recombinant Human DTX4 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DTX4 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products