Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human XKR8, N-His & N-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H6D3
Molecular weight:
22.80 kDa

Original price was: €218.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Arg69–Arg158
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human XKR8, N-His & N-SUMO

Product name ARO-P13103-100
Uniprot ID Q9H6D3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RADPAGLHGSQPPRRCLALLHLLQLGYLYRCVQELRQGLLVWQQEEPSEFDLAYADFLALDISMLRLFETFLETAPQLTLVLAIMLQSGR
Molecular weight 22.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg69-Arg158
Aliases /Synonyms hXkr8, XKR8, XK-related protein 8, XRG8
Reference ARO-P13103
Note For research use only.
Molecular Constructor
Arg69–Arg158
Product name ARO-P13103-1MG
Uniprot ID Q9H6D3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RADPAGLHGSQPPRRCLALLHLLQLGYLYRCVQELRQGLLVWQQEEPSEFDLAYADFLALDISMLRLFETFLETAPQLTLVLAIMLQSGR
Molecular weight 22.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg69-Arg158
Aliases /Synonyms hXkr8, XKR8, XK-related protein 8, XRG8
Reference ARO-P13103
Note For research use only.
Molecular Constructor
Arg69–Arg158
Product name ARO-P13103-50
Uniprot ID Q9H6D3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RADPAGLHGSQPPRRCLALLHLLQLGYLYRCVQELRQGLLVWQQEEPSEFDLAYADFLALDISMLRLFETFLETAPQLTLVLAIMLQSGR
Molecular weight 22.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg69-Arg158
Aliases /Synonyms hXkr8, XKR8, XK-related protein 8, XRG8
Reference ARO-P13103
Note For research use only.
Molecular Constructor
Arg69–Arg158

Recombinant Human XKR8: Structure, Activity, and Application

Introduction

Recombinant Human XKR8 (XK-related protein 8) is a protein that plays a crucial role in the regulation of cell death and survival. It is a member of the XK family of proteins, which are known for their involvement in various cellular processes such as cell adhesion, migration, and apoptosis. Recombinant Human XKR8 is a synthetic version of the naturally occurring human XKR8 protein, produced through genetic engineering techniques. In this article, we will discuss the structure, activity, and application of Recombinant Human XKR8.

Structure of Recombinant Human XKR8

Recombinant Human XKR8 is a transmembrane protein that consists of 490 amino acids. It has a molecular weight of approximately 55 kDa and is composed of two main domains – an N-terminal intracellular domain and a C-terminal extracellular domain. The N-terminal domain contains a proline-rich region, which is important for protein-protein interactions, and a death domain, which is essential for its pro-apoptotic activity. The C-terminal domain contains a large extracellular loop that is involved in cell adhesion and migration.

Activity of Recombinant Human XKR8

Recombinant Human XKR8 is primarily known for its pro-apoptotic activity, which means it promotes cell death. This activity is mediated through its death domain, which interacts with other death domain-containing proteins, such as Fas-associated protein with death domain (FADD) and tumor necrosis factor receptor 1-associated death domain protein (TRADD). These interactions lead to the activation of caspases, which are enzymes that play a central role in the execution of cell death. In addition to its pro-apoptotic activity, Recombinant Human XKR8 also has a role in cell adhesion and migration through its extracellular loop domain. It has been shown to interact with integrins, which are transmembrane proteins that mediate cell adhesion to the extracellular matrix.

Application of Recombinant Human XKR8

Recombinant Human XKR8 has a wide range of applications in both research and therapeutic settings. Its pro-apoptotic activity makes it a valuable tool for studying cell death and survival mechanisms. It can be used to induce apoptosis in cell culture experiments and to investigate the role of XKR8 in different cellular processes. In addition, Recombinant Human XKR8 has potential therapeutic applications, particularly in cancer treatment. Its ability to induce cell death makes it a promising candidate for anti-cancer therapies. In fact, studies have shown that XKR8 is downregulated in various types of cancer, and its overexpression can inhibit tumor growth and induce cell death in cancer cells.

Recombinant Human XKR8 as an Antigen

Recombinant Human XKR8 can also be used as an antigen in the development of vaccines and diagnostic tests. Its extracellular loop domain, which is involved in cell adhesion, can act as an immunogenic region, eliciting an immune response in the body. This can be beneficial in the development of vaccines against diseases such as cancer, where XKR8 is downregulated. Additionally, specific antibodies against Recombinant Human XKR8 can be used in diagnostic tests to detect its expression levels in different tissues and diseases.

Conclusion

In summary, Recombinant Human XKR8 is a transmembrane protein with a pro-apoptotic activity mediated through its death domain and a role in cell adhesion and migration through its extracellular loop domain.

Recombinant Human XKR8, N-His & N-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human XKR8, N-His & N-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products