Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DSPP, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NZW4
Molecular weight:
16.33 kDa

Original price was: €260.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Ile16–Ala146
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DSPP, N-His

Product name ARO-P13048-100
Uniprot ID Q9NZW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNA
Molecular weight 16.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile16-Ala146
Aliases /Synonyms DPP, DSP, Dentin sialophosphoprotein, DSPP, Dentin phosphophoryn
Reference ARO-P13048
Note For research use only.
Molecular Constructor
Ile16–Ala146
Product name ARO-P13048-1MG
Uniprot ID Q9NZW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNA
Molecular weight 16.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile16-Ala146
Aliases /Synonyms DPP, DSP, Dentin sialophosphoprotein, DSPP, Dentin phosphophoryn
Reference ARO-P13048
Note For research use only.
Molecular Constructor
Ile16–Ala146
Product name ARO-P13048-50
Uniprot ID Q9NZW4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IPVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNA
Molecular weight 16.33 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile16-Ala146
Aliases /Synonyms DPP, DSP, Dentin sialophosphoprotein, DSPP, Dentin phosphophoryn
Reference ARO-P13048
Note For research use only.
Molecular Constructor
Ile16–Ala146

Introduction

Recombinant Human DSPP (Dentin Sialophosphoprotein) is a protein that plays a crucial role in the formation and mineralization of teeth. It is a member of the small integrin-binding ligand N-linked glycoprotein (SIBLING) family, which is known for its involvement in the regulation of bone and tooth development. Recombinant Human DSPP is produced through recombinant DNA technology and has a wide range of applications in dental research and clinical practice.

Structure of Recombinant Human DSPP

Recombinant Human DSPP is a large protein consisting of 1,330 amino acids. It is mainly composed of two major domains: the dentin sialoprotein (DSP) domain and the dentin phosphoprotein (DPP) domain. The DSP domain is located at the N-terminus and contains 10 repeats of the highly conserved DSP motif. This domain is responsible for the binding of DSPP to collagen, which is essential for the formation of mineralized tissues. The DPP domain, on the other hand, is located at the C-terminus and contains multiple phosphorylated serine residues. This domain is involved in the regulation of mineralization and has been shown to interact with various proteins and enzymes involved in tooth development.

Activity of Recombinant Human DSPP

Recombinant Human DSPP has been extensively studied for its role in tooth development and mineralization. It has been shown to play a crucial role in the formation of dentin, the hard tissue that makes up the majority of the tooth structure. DSPP is secreted by odontoblasts, the cells responsible for dentin formation, and is cleaved into two smaller proteins, DSP and DPP. These proteins then interact with other molecules in the extracellular matrix to promote the mineralization process.

In addition to its role in tooth development, Recombinant Human DSPP has also been found to have antimicrobial properties. It has been shown to inhibit the growth of bacteria commonly found in the oral cavity, such as Streptococcus mutans, which is known to cause tooth decay. This antimicrobial activity of DSPP makes it a potential candidate for the development of new dental treatments and products.

Applications of Recombinant Human DSPP

Recombinant Human DSPP has a wide range of applications in dental research and clinical practice. One of its main uses is in the study of tooth development and mineralization. Researchers use recombinant DSPP to better understand the mechanisms involved in these processes and to develop new treatments for dental diseases such as tooth decay and dentin hypersensitivity.

Another important application of Recombinant Human DSPP is in the development of dental biomaterials. DSPP has been shown to enhance the adhesion and proliferation of dental stem cells, making it a promising candidate for the development of new biomaterials for tooth repair and regeneration. Its antimicrobial properties also make it a potential ingredient in dental materials to prevent bacterial growth and promote healing.

In addition, Recombinant Human DSPP is also used in diagnostic tests for dental diseases. Its presence in the saliva has been linked to various dental conditions, and its detection can aid in the early diagnosis and treatment of these diseases.

Conclusion

Recombinant Human DSPP is a crucial protein in tooth development and mineralization. Its structure, activity, and wide range of applications make it a valuable tool in dental research and clinical practice. With further studies and advancements in technology, this protein holds great potential for the development of new dental treatments and products.

Recombinant Human DSPP, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DSPP, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products