Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DNAJA1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P31689
Molecular weight:
27.14 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Asn106–Asn327
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DNAJA1 Protein, N-His

Product name ARO-P11706-100
Uniprot ID P31689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVN
Molecular weight 27.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn106-Asn327
Aliases /Synonyms DnaJ protein homolog 2, DNAJA1, Heat shock protein J2, HDJ2, HSJ-2, HSJ2, HSPF4, Heat shock 40 kDa protein 4, HSDJ, DNAJ2, DnaJ homolog subfamily A member 1, Human DnaJ protein 2, hDj-2
Reference ARO-P11706
Note For research use only.
Molecular Constructor
Asn106–Asn327
Product name ARO-P11706-1MG
Uniprot ID P31689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVN
Molecular weight 27.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn106-Asn327
Aliases /Synonyms DnaJ protein homolog 2, DNAJA1, Heat shock protein J2, HDJ2, HSJ-2, HSJ2, HSPF4, Heat shock 40 kDa protein 4, HSDJ, DNAJ2, DnaJ homolog subfamily A member 1, Human DnaJ protein 2, hDj-2
Reference ARO-P11706
Note For research use only.
Molecular Constructor
Asn106–Asn327
Product name ARO-P11706-50
Uniprot ID P31689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVN
Molecular weight 27.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn106-Asn327
Aliases /Synonyms DnaJ protein homolog 2, DNAJA1, Heat shock protein J2, HDJ2, HSJ-2, HSJ2, HSPF4, Heat shock 40 kDa protein 4, HSDJ, DNAJ2, DnaJ homolog subfamily A member 1, Human DnaJ protein 2, hDj-2
Reference ARO-P11706
Note For research use only.
Molecular Constructor
Asn106–Asn327

Introduction to Recombinant Human DNAJA1 Protein

Recombinant Human DNAJA1 protein, also known as DnaJ homolog subfamily A member 1, is a heat shock protein that plays a crucial role in protein folding and quality control in the cell. It is a member of the DnaJ family of proteins, which are molecular chaperones that assist in the proper folding of other proteins.

Structure of Recombinant Human DNAJA1 Protein

The recombinant human DNAJA1 protein is a 40 kDa protein consisting of 347 amino acids. It contains a highly conserved J domain at its N-terminus, which is responsible for its chaperone activity. This J domain interacts with the ATPase domain of Hsp70, another heat shock protein, to facilitate protein folding.

In addition to the J domain, the recombinant human DNAJA1 protein also contains a cysteine-rich domain and a zinc finger domain. These domains are involved in protein-protein interactions and are essential for the chaperone activity of DNAJA1.

Activity of Recombinant Human DNAJA1 Protein

The main activity of recombinant human DNAJA1 protein is to assist in the proper folding of newly synthesized proteins. It does this by binding to exposed hydrophobic regions of unfolded or misfolded proteins and preventing them from forming aggregates. This chaperone activity is essential for maintaining protein homeostasis and preventing the accumulation of misfolded proteins, which can lead to cellular dysfunction and disease.

In addition to its chaperone activity, recombinant human DNAJA1 protein also plays a role in protein degradation. It interacts with the ubiquitin-proteasome system, a cellular pathway responsible for the degradation of damaged or unwanted proteins. DNAJA1 helps in the recognition and targeting of proteins for degradation, ensuring that only properly folded and functional proteins remain in the cell.

Application of Recombinant Human DNAJA1 Protein

Recombinant human DNAJA1 protein has a wide range of applications in both research and therapeutic settings. Its chaperone activity and involvement in protein degradation make it a valuable tool for studying protein folding and quality control mechanisms in the cell.

In research, recombinant human DNAJA1 protein is often used to study the effects of protein misfolding and aggregation on cellular function. It can also be used to investigate the role of DNAJA1 in specific diseases, such as neurodegenerative disorders that are characterized by the accumulation of misfolded proteins.

In therapeutic settings, recombinant human DNAJA1 protein has shown potential for the treatment of protein misfolding diseases. By enhancing the chaperone activity of DNAJA1, it may be possible to prevent or reverse the accumulation of misfolded proteins and alleviate the symptoms of these diseases.

Conclusion

Recombinant Human DNAJA1 protein is a crucial player in protein folding and quality control in the cell. Its unique structure and chaperone activity make it an essential component of the cellular machinery that ensures proper protein function. With its wide range of applications in research and potential therapeutic uses, recombinant human DNAJA1 protein continues to be a subject of interest and investigation in the scientific community.

Recombinant Human DNAJA1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DNAJA1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products