Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DLST/OGDC-E2 Protein, C-Strep

Host species:
Insect cells
Origin species:
Human
Uniprot ID:
P36957
Molecular weight:
42.70 kDa

Original price was: €329.00.Current price is: €294.00.

50ug 11% OFF + 294 loyalty points
Asp68–Leu453 Strep
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DLST/OGDC-E2 Protein, C-Strep

Product name ARO-P15979-100
Uniprot ID P36957
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Molecular weight 42.70 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Asp68-Leu453
Aliases /Synonyms Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial, 2.3.1.61, 2-oxoglutarate dehydrogenase complex component E2, OGDC-E2, Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, E2K, DLST, DLTS
Reference ARO-P15979
Note For research use only.
Molecular Constructor
Asp68–Leu453 Strep
Product name ARO-P15979-1MG
Uniprot ID P36957
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Molecular weight 42.70 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Asp68-Leu453
Aliases /Synonyms Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial, 2.3.1.61, 2-oxoglutarate dehydrogenase complex component E2, OGDC-E2, Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, E2K, DLST, DLTS
Reference ARO-P15979
Note For research use only.
Molecular Constructor
Asp68–Leu453 Strep
Product name ARO-P15979-50
Uniprot ID P36957
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence DDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Molecular weight 42.70 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Asp68-Leu453
Aliases /Synonyms Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial, 2.3.1.61, 2-oxoglutarate dehydrogenase complex component E2, OGDC-E2, Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex, E2K, DLST, DLTS
Reference ARO-P15979
Note For research use only.
Molecular Constructor
Asp68–Leu453 Strep

There are no reviews yet.

Be the first to review “Recombinant Human DLST/OGDC-E2 Protein, C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products