Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DBT/BCOADC-E2 Protein, C-Strep

Host species:
Insect cells
Origin species:
Human
Uniprot ID:
P11182
Molecular weight:
47.68 kDa

Original price was: €365.00.Current price is: €294.00.

50ug 19% OFF + 294 loyalty points
Gly62–Lys482 Strep
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DBT/BCOADC-E2 Protein, C-Strep

Product name ARO-P15980-100
Uniprot ID P11182
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVSQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
Molecular weight 47.68 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Gly62-Lys482
Aliases /Synonyms Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial, 2.3.1.168, 52 kDa mitochondrial autoantigen of primary biliary cirrhosis, Branched chain 2-oxo-acid dehydrogenase complex component E2, BCOADC-E2, Branched-chain alpha-keto acid dehydrogenase complex component E2, BCKAD-E2, BCKADE2, BCKDH-E2, Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, Dihydrolipoamide branched chain transacylase, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, DBT, BCATE2, BCKDHE2
Reference ARO-P15980
Note For research use only.
Molecular Constructor
Gly62–Lys482 Strep
Product name ARO-P15980-1MG
Uniprot ID P11182
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVSQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
Molecular weight 47.68 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Gly62-Lys482
Aliases /Synonyms Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial, 2.3.1.168, 52 kDa mitochondrial autoantigen of primary biliary cirrhosis, Branched chain 2-oxo-acid dehydrogenase complex component E2, BCOADC-E2, Branched-chain alpha-keto acid dehydrogenase complex component E2, BCKAD-E2, BCKADE2, BCKDH-E2, Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, Dihydrolipoamide branched chain transacylase, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, DBT, BCATE2, BCKDHE2
Reference ARO-P15980
Note For research use only.
Molecular Constructor
Gly62–Lys482 Strep
Product name ARO-P15980-50
Uniprot ID P11182
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence GQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVSQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
Molecular weight 47.68 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Insect cells
Fragment Type Gly62-Lys482
Aliases /Synonyms Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial, 2.3.1.168, 52 kDa mitochondrial autoantigen of primary biliary cirrhosis, Branched chain 2-oxo-acid dehydrogenase complex component E2, BCOADC-E2, Branched-chain alpha-keto acid dehydrogenase complex component E2, BCKAD-E2, BCKADE2, BCKDH-E2, Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, Dihydrolipoamide branched chain transacylase, Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase, DBT, BCATE2, BCKDHE2
Reference ARO-P15980
Note For research use only.
Molecular Constructor
Gly62–Lys482 Strep

There are no reviews yet.

Be the first to review “Recombinant Human DBT/BCOADC-E2 Protein, C-Strep”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products