Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DIRAS1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95057
Molecular weight:
21.44 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Met1–Arg171
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DIRAS1 Protein, N-His

Product name ARO-P11584-100
Uniprot ID O95057
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRR
Molecular weight 21.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg171
Aliases /Synonyms Distinct subgroup of the Ras family member 1, RIG, GBTS1, Rig, DIRAS1, GTP-binding protein Di-Ras1, Small GTP-binding tumor suppressor 1, Ras-related inhibitor of cell growth
Reference ARO-P11584
Note For research use only.
Molecular Constructor
Met1–Arg171
Product name ARO-P11584-1MG
Uniprot ID O95057
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRR
Molecular weight 21.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg171
Aliases /Synonyms Distinct subgroup of the Ras family member 1, RIG, GBTS1, Rig, DIRAS1, GTP-binding protein Di-Ras1, Small GTP-binding tumor suppressor 1, Ras-related inhibitor of cell growth
Reference ARO-P11584
Note For research use only.
Molecular Constructor
Met1–Arg171
Product name ARO-P11584-50
Uniprot ID O95057
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRR
Molecular weight 21.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg171
Aliases /Synonyms Distinct subgroup of the Ras family member 1, RIG, GBTS1, Rig, DIRAS1, GTP-binding protein Di-Ras1, Small GTP-binding tumor suppressor 1, Ras-related inhibitor of cell growth
Reference ARO-P11584
Note For research use only.
Molecular Constructor
Met1–Arg171

Introduction

Recombinant proteins have become essential tools in various fields of study, including medicine, biotechnology, and research. One such protein is the Recombinant Human DIRAS1 Protein, which has gained attention for its unique structure, activity, and potential applications. In this article, we will explore the various aspects of this protein in detail.

Structure of Recombinant Human DIRAS1 Protein

DIRAS1 (Distinctly Induced by Retinoic Acid 16) is a member of the small GTPase superfamily, which plays a crucial role in cellular signaling and regulation. The human DIRAS1 gene is located on chromosome 19 and encodes a protein of 26 kDa. The recombinant form of this protein is produced by cloning the human DIRAS1 gene into a suitable expression vector and expressing it in a host organism, such as bacteria or yeast.

The recombinant human DIRAS1 protein consists of 234 amino acids and has a unique structure with a highly conserved GTP-binding domain. This domain is responsible for the protein’s GTPase activity, which is essential for its function. Additionally, DIRAS1 also contains a C-terminal CAAX motif, which is crucial for its membrane localization and interaction with other proteins.

Activity of Recombinant Human DIRAS1 Protein

The primary function of DIRAS1 is to regulate various cellular processes, including cell proliferation, differentiation, and survival. It does so by acting as a molecular switch, cycling between its active GTP-bound form and inactive GDP-bound form. The recombinant form of DIRAS1 retains this activity and can bind to GTP and GDP molecules, thus modulating its function.

Studies have shown that DIRAS1 is involved in the regulation of several signaling pathways, such as the MAPK/ERK and PI3K/AKT pathways, which are crucial for cell growth and survival. It also plays a role in the activation of Rho GTPases, which are essential for cell migration and cytoskeletal organization. Moreover, DIRAS1 has been linked to the regulation of cell cycle progression and apoptosis, making it a potential target for cancer therapy.

Application of Recombinant Human DIRAS1 Protein

The unique structure and activity of recombinant human DIRAS1 protein make it a valuable tool in various applications. One of the primary uses of this protein is in the study of its function and role in cellular processes. Recombinant DIRAS1 can be expressed and purified in large quantities, making it ideal for biochemical and structural studies.

Furthermore, the potential involvement of DIRAS1 in cancer and other diseases makes it a promising target for drug development. Recombinant human DIRAS1 protein can be used in drug screening assays to identify potential inhibitors or activators of its activity. It can also be used in pre-clinical studies to evaluate the efficacy and safety of these potential drugs.

Another potential application of recombinant DIRAS1 is in the development of diagnostic tools. As DIRAS1 expression has been linked to certain cancers, it can serve as a biomarker for disease detection and monitoring. Recombinant DIRAS1 protein can be used in immunoassays to detect the presence of DIRAS1 in patient samples, aiding in early diagnosis and treatment.

Conclusion

The Recombinant Human DIRAS1 Protein is a unique and versatile protein with a crucial role in cellular signaling and regulation. Its structure, activity, and potential applications make it a valuable tool in various fields of study. Further research on this protein may uncover its full potential and lead to the development of novel therapies and diagnostic tools.

Recombinant Human DIRAS1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DIRAS1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products