Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DGKE, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52429
Molecular weight:
31.09 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
His Leu243–Gly502
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DGKE, N-His

Product name ARO-P13651-100
Uniprot ID P52429
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LLNPVQVFDVTKTPPIKALQLCTLLPYYSARVLVCGGDGTVGWVLDAVDDMKIKGQEKYIPQVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYYNLRKPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQECKDLNKKVELELDGERVALPSLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVVGVYGSFHCAQIQVKLANPFRIG
Molecular weight 31.09 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu243-Gly502
Aliases /Synonyms DGKE, Diglyceride kinase epsilon, DAG kinase epsilon, DGK-epsilon, Diacylglycerol kinase epsilon, DAGK5
Reference ARO-P13651
Note For research use only.
Molecular Constructor
His Leu243–Gly502
Product name ARO-P13651-1MG
Uniprot ID P52429
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LLNPVQVFDVTKTPPIKALQLCTLLPYYSARVLVCGGDGTVGWVLDAVDDMKIKGQEKYIPQVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYYNLRKPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQECKDLNKKVELELDGERVALPSLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVVGVYGSFHCAQIQVKLANPFRIG
Molecular weight 31.09 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu243-Gly502
Aliases /Synonyms DGKE, Diglyceride kinase epsilon, DAG kinase epsilon, DGK-epsilon, Diacylglycerol kinase epsilon, DAGK5
Reference ARO-P13651
Note For research use only.
Molecular Constructor
His Leu243–Gly502
Product name ARO-P13651-50
Uniprot ID P52429
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LLNPVQVFDVTKTPPIKALQLCTLLPYYSARVLVCGGDGTVGWVLDAVDDMKIKGQEKYIPQVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYYNLRKPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQECKDLNKKVELELDGERVALPSLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVVGVYGSFHCAQIQVKLANPFRIG
Molecular weight 31.09 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu243-Gly502
Aliases /Synonyms DGKE, Diglyceride kinase epsilon, DAG kinase epsilon, DGK-epsilon, Diacylglycerol kinase epsilon, DAGK5
Reference ARO-P13651
Note For research use only.
Molecular Constructor
His Leu243–Gly502

Introduction

Recombinant Human DGKE (Diacylglycerol Kinase Epsilon) is a protein that plays a crucial role in the regulation of lipid signaling pathways. It is a member of the diacylglycerol kinase (DGK) family and is involved in the metabolism of diacylglycerol (DAG), a key intermediate in lipid metabolism. Recombinant Human DGKE is produced through recombinant DNA technology, making it a valuable tool for research and potential therapeutic applications.

Structure of Recombinant Human DGKE

Recombinant Human DGKE is a 105 kDa protein consisting of 930 amino acids. It contains two conserved domains, a catalytic domain and a regulatory domain. The catalytic domain is responsible for the enzymatic activity of DGKE, while the regulatory domain helps in the localization and regulation of the enzyme. The structure of Recombinant Human DGKE is highly conserved across different species, indicating its importance in cellular processes.

Activity of Recombinant Human DGKE

The main function of Recombinant Human DGKE is to phosphorylate DAG, converting it into phosphatidic acid (PA). This reaction is essential for the regulation of DAG levels, which in turn affects various cellular processes such as cell growth, differentiation, and apoptosis. Recombinant Human DGKE is also involved in the regulation of lipid signaling pathways, including the phosphoinositide 3-kinase (PI3K) and protein kinase C (PKC) pathways.

Applications of Recombinant Human DGKE

Recombinant Human DGKE has various applications in both research and potential therapeutic areas. Some of the major applications are:

1. Research

Recombinant Human DGKE is a valuable tool for studying the role of DAG in cellular processes. It can be used to investigate the function of DGKE in different pathways and its interaction with other proteins. Recombinant Human DGKE can also be used to study the effects of mutations or genetic variations in the enzyme, providing insights into its structure and function.

2. Therapeutic potential

Abnormalities in the DAG metabolism have been linked to various diseases, including cancer, diabetes, and neurological disorders. Recombinant Human DGKE has shown potential as a therapeutic target for these diseases. Its ability to regulate DAG levels and lipid signaling pathways makes it a promising candidate for drug development.

3. Diagnosis and monitoring

Recombinant Human DGKE can also be used as a diagnostic tool for certain diseases. Abnormal levels of DGKE have been observed in patients with certain types of cancer and diabetes, making it a potential biomarker for disease diagnosis and monitoring.

4. Vaccine development

Recombinant Human DGKE has been identified as an antigen in various pathogens, including bacteria and viruses. This makes it a potential target for vaccine development, as it can induce an immune response against these pathogens.

Conclusion

Recombinant Human DGKE is a crucial enzyme involved in the regulation of lipid signaling pathways. Its structure and activity make it a valuable tool for research and potential therapeutic applications. With its diverse applications and potential as a drug target, Recombinant Human DGKE holds great promise for future advancements in the field of lipid metabolism and related diseases.

Recombinant Human DGKE, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DGKE, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products