Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DEFA3, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P59666
Molecular weight:
34.99 kDa

Original price was: €269.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
GST Pro21–Cys94
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DEFA3, N-GST

Product name ARO-P13598-100
Uniprot ID P59666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Molecular weight 34.99 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro21-Cys94
Aliases /Synonyms HP3, Neutrophil defensin 3, HNP-3, HNP-2, DEF3, HP-3, Defensin, alpha 3, DEFA3, HP-2, HP2
Reference ARO-P13598
Note For research use only.
Molecular Constructor
GST Pro21–Cys94
Product name ARO-P13598-1MG
Uniprot ID P59666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Molecular weight 34.99 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro21-Cys94
Aliases /Synonyms HP3, Neutrophil defensin 3, HNP-3, HNP-2, DEF3, HP-3, Defensin, alpha 3, DEFA3, HP-2, HP2
Reference ARO-P13598
Note For research use only.
Molecular Constructor
GST Pro21–Cys94
Product name ARO-P13598-50
Uniprot ID P59666
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Molecular weight 34.99 kDa
Protein delivered with Tag? N-Terminal GST Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro21-Cys94
Aliases /Synonyms HP3, Neutrophil defensin 3, HNP-3, HNP-2, DEF3, HP-3, Defensin, alpha 3, DEFA3, HP-2, HP2
Reference ARO-P13598
Note For research use only.
Molecular Constructor
GST Pro21–Cys94

Introduction

Recombinant Human DEFA3, also known as human defensin alpha 3, is a small, cationic protein that plays a crucial role in the innate immune response against microbial infections. It is one of the many defensin proteins found in humans, which are known for their antimicrobial and immunomodulatory properties. In this article, we will delve into the structure, activity, and applications of recombinant human DEFA3.

Structure of Recombinant Human DEFA3

Recombinant Human DEFA3 is a 29 amino acid long protein, with a molecular weight of approximately 3.5 kDa. It is a member of the alpha-defensin family, which is characterized by a six-cysteine motif that forms three disulfide bonds. The three-dimensional structure of recombinant human DEFA3 is highly conserved, with a beta-sheet structure stabilized by the three disulfide bonds. This unique structural feature allows the protein to maintain its stability and function in various environments.

Activity of Recombinant Human DEFA3

Recombinant Human DEFA3 exhibits potent antimicrobial activity against a wide range of microorganisms, including bacteria, fungi, and viruses. It exerts its antimicrobial effects by disrupting the cell membrane of these pathogens, leading to cell lysis and death. In addition to its antimicrobial activity, recombinant human DEFA3 also has immunomodulatory properties. It can stimulate the production of pro-inflammatory cytokines and chemokines, which are essential for recruiting immune cells to the site of infection. This dual activity of recombinant human DEFA3 makes it a powerful weapon in the fight against infectious diseases.

Applications of Recombinant Human DEFA3

The unique properties of recombinant human DEFA3 make it a promising candidate for various applications in the field of medicine and biotechnology.

Antimicrobial Agent

Due to its potent antimicrobial activity, recombinant human DEFA3 can be used as an alternative to traditional antibiotics. With the rise of antibiotic-resistant bacteria, there is a growing need for new antimicrobial agents, and recombinant human DEFA3 has shown promising results in this regard. It has been tested against various drug-resistant bacteria, such as methicillin-resistant Staphylococcus aureus (MRSA) and vancomycin-resistant Enterococcus (VRE), and has shown strong inhibitory effects.

Therapeutic Agent for Inflammatory Diseases

Recombinant human DEFA3’s immunomodulatory properties make it a potential therapeutic agent for inflammatory diseases. It has been shown to reduce inflammation in various models of inflammatory diseases, such as colitis, arthritis, and psoriasis. It does so by regulating the production of pro-inflammatory cytokines and chemokines, thereby reducing the recruitment of immune cells to the site of inflammation.

Adjuvant in Vaccine Development

Recombinant human DEFA3 has been studied as an adjuvant in vaccine development. Adjuvants are substances that enhance the immune response to a vaccine, making it more effective. Recombinant human DEFA3 has been shown to enhance the immune response to various vaccines, including influenza and hepatitis B vaccines. This makes it a potential candidate for use in future vaccine formulations.

Diagnostic Tool for Infectious Diseases

Recombinant human DEFA3 can also be used as a diagnostic tool for infectious diseases. Its antimicrobial activity against a wide range of pathogens makes it a potential candidate for detecting and identifying these microorganisms. It has been tested in various diagnostic assays, and its ability to detect and differentiate between different pathogens has been demonstrated.

Research Tool

Recombinant human DEFA3 is also

Recombinant Human DEFA3, N-GST

There are no reviews yet.

Be the first to review “Recombinant Human DEFA3, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products