Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P42830
Molecular weight:
18.62 kDa

Original price was: €279.00.Current price is: €223.00.

50ug 20% OFF + 223 loyalty points
Gly57–Asn114
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO

Product name ARO-P11205-100
Uniprot ID P42830
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Molecular weight 18.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly57-Asn114
Aliases /Synonyms C-X-C motif chemokine 5, ENA-78(1-78), Neutrophil-activating peptide ENA-78, ENA78, SCYB5, Small-inducible cytokine B5, CXCL5, Epithelial-derived neutrophil-activating protein 78
Reference ARO-P11205
Note For research use only.
Molecular Constructor
Gly57–Asn114
Product name ARO-P11205-1MG
Uniprot ID P42830
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Molecular weight 18.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly57-Asn114
Aliases /Synonyms C-X-C motif chemokine 5, ENA-78(1-78), Neutrophil-activating peptide ENA-78, ENA78, SCYB5, Small-inducible cytokine B5, CXCL5, Epithelial-derived neutrophil-activating protein 78
Reference ARO-P11205
Note For research use only.
Molecular Constructor
Gly57–Asn114
Product name ARO-P11205-50
Uniprot ID P42830
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Molecular weight 18.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly57-Asn114
Aliases /Synonyms C-X-C motif chemokine 5, ENA-78(1-78), Neutrophil-activating peptide ENA-78, ENA78, SCYB5, Small-inducible cytokine B5, CXCL5, Epithelial-derived neutrophil-activating protein 78
Reference ARO-P11205
Note For research use only.
Molecular Constructor
Gly57–Asn114

Introduction

Recombinant Human CXCL5/ENA-78 Protein, also known as epithelial cell-derived neutrophil-activating peptide 78 (ENA-78), is a chemokine protein that plays a crucial role in the immune system. This protein is produced through recombinant DNA technology, making it a valuable tool in various scientific research and applications. In this article, we will discuss the structure, activity, and applications of Recombinant Human CXCL5/ENA-78 Protein.

Structure of Recombinant Human CXCL5/ENA-78 Protein

Recombinant Human CXCL5/ENA-78 Protein is a small protein consisting of 78 amino acids with a molecular weight of approximately 8.7 kDa. It belongs to the CXC chemokine family and is primarily produced by epithelial cells in response to inflammatory stimuli. The protein has a conserved structure with a highly conserved N-terminal region and a less conserved C-terminal region. The N-terminal region contains four cysteine residues that form two disulfide bonds, which are essential for the protein’s stability and activity.

Activity of Recombinant Human CXCL5/ENA-78 Protein

Recombinant Human CXCL5/ENA-78 Protein is a potent chemoattractant for neutrophils, a type of white blood cell that plays a crucial role in the body’s immune response. It binds to the CXCR2 receptor on the surface of neutrophils, inducing their migration towards the site of inflammation. This protein also has pro-inflammatory properties, as it can stimulate the production of other inflammatory cytokines and chemokines. Additionally, Recombinant Human CXCL5/ENA-78 Protein can enhance the adhesion of neutrophils to endothelial cells, promoting their recruitment to the site of injury or infection.

Applications of Recombinant Human CXCL5/ENA-78 Protein

Due to its potent activity and role in the immune system, Recombinant Human CXCL5/ENA-78 Protein has various applications in scientific research. Here are some of its most common applications:

1. Study of Inflammation and Immune Response

Recombinant Human CXCL5/ENA-78 Protein is widely used in the study of inflammation and immune response. Its ability to recruit neutrophils and stimulate the production of other inflammatory molecules makes it a valuable tool in understanding the mechanisms of inflammation and immune system regulation. This protein can also be used to investigate the role of specific chemokines and cytokines in various diseases and conditions.

2. Drug Development

The pro-inflammatory properties of Recombinant Human CXCL5/ENA-78 Protein make it a potential target for drug development. By blocking its activity, it may be possible to reduce the severity of inflammatory diseases such as rheumatoid arthritis, asthma, and inflammatory bowel disease. On the other hand, enhancing its activity may be beneficial in certain conditions, such as wound healing and tissue repair.

3. Diagnostic Tool

Recombinant Human CXCL5/ENA-78 Protein can also be used as a diagnostic tool for various diseases. Elevated levels of this protein have been observed in patients with inflammatory conditions, making it a potential biomarker for disease diagnosis and monitoring. Furthermore, measuring the levels of this protein in bodily fluids, such as blood or urine, can provide valuable information about the extent and severity of inflammation in the body.

4. Vaccine Development

Recombinant Human CXCL5/ENA-78 Protein has also been investigated as a potential antigen for vaccine development. By incorporating this protein into a vaccine, it may be possible to induce a specific immune response against it, providing protection against infections and diseases that involve this protein.

Conclusion

In summary, Recombinant Human CXCL5/ENA-78 Protein is a small but powerful chemokine with various applications in scientific research. Its structure

Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products