Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CTPS2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRF8
Molecular weight:
35.43 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
Met1–Lys297
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CTPS2 Protein, N-His

Product name ARO-P11419-100
Uniprot ID Q9NRF8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQK
Molecular weight 35.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys297
Aliases /Synonyms CTPS2, CTP synthetase 2, UTP--ammonia ligase 2, CTP synthase 2
Reference ARO-P11419
Note For research use only.
Molecular Constructor
Met1–Lys297
Product name ARO-P11419-1MG
Uniprot ID Q9NRF8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQK
Molecular weight 35.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys297
Aliases /Synonyms CTPS2, CTP synthetase 2, UTP--ammonia ligase 2, CTP synthase 2
Reference ARO-P11419
Note For research use only.
Molecular Constructor
Met1–Lys297
Product name ARO-P11419-50
Uniprot ID Q9NRF8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQK
Molecular weight 35.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys297
Aliases /Synonyms CTPS2, CTP synthetase 2, UTP--ammonia ligase 2, CTP synthase 2
Reference ARO-P11419
Note For research use only.
Molecular Constructor
Met1–Lys297

Title: Introduction to Recombinant Human CTPS2 Protein

Recombinant human CTPS2 protein, also known as CTP synthase 2, is a key enzyme in the pyrimidine biosynthesis pathway. It is involved in the conversion of uridine triphosphate (UTP) to cytidine triphosphate (CTP), an essential nucleotide for DNA and RNA synthesis. In this article, we will explore the structure, activity, and applications of recombinant human CTPS2 protein.

Title: Structure of Recombinant Human CTPS2 Protein

Recombinant human CTPS2 protein is a homotetramer, meaning it is composed of four identical subunits. Each subunit consists of two domains: an N-terminal glutamine amidotransferase (GAT) domain and a C-terminal CTP synthase (CTPS) domain. The GAT domain is responsible for the glutamine-dependent amidotransferase activity, while the CTPS domain catalyzes the conversion of UTP to CTP. The four subunits are arranged in a head-to-tail fashion, forming a central channel where the catalytic site is located.

Title: Activity of Recombinant Human CTPS2 Protein

Recombinant human CTPS2 protein plays a crucial role in the regulation of cellular CTP levels. It is highly conserved among species and is essential for cell growth and proliferation. The enzyme activity of CTPS2 is regulated by the availability of its substrate, glutamine, and the allosteric inhibitor, CTP. When glutamine is abundant, CTPS2 activity is stimulated, leading to increased CTP production. On the other hand, high levels of CTP inhibit CTPS2 activity, providing a negative feedback mechanism to maintain cellular CTP levels.

Title: Applications of Recombinant Human CTPS2 Protein

Recombinant human CTPS2 protein has a wide range of applications in both research and therapeutic settings. One of its main uses is in the production of recombinant proteins. CTPS2 is often co-expressed with target proteins in recombinant protein expression systems to increase CTP levels and improve protein yield. Additionally, CTPS2 has been shown to play a role in the regulation of immune responses, making it a potential target for immunomodulatory therapies.

Title: Recombinant Human CTPS2 Protein as an Antigen

CTPS2 has been identified as an antigen in autoimmune diseases such as systemic lupus erythematosus (SLE) and rheumatoid arthritis (RA). Autoantibodies against CTPS2 have been found in the serum of patients with these conditions, suggesting a potential role of CTPS2 in the pathogenesis of these diseases. Recombinant human CTPS2 protein can be used as an antigen in diagnostic tests to detect these autoantibodies and aid in the diagnosis of SLE and RA.

Title: Future Directions and Conclusion

The study of recombinant human CTPS2 protein is an active area of research, and there is still much to be discovered about its structure, activity, and applications. Further studies on the regulation of CTPS2 activity and its role in various diseases may lead to the development of new therapeutic strategies. Additionally, the use of recombinant CTPS2 protein in protein expression systems and as an antigen in diagnostic tests holds great promise for future advancements in biotechnology and medicine.

In conclusion, recombinant human CTPS2 protein is a vital enzyme involved in the pyrimidine biosynthesis pathway. Its structure and activity have been extensively studied, and it has various applications in research and therapeutics. As our understanding of CTPS2 continues to grow, we can expect to see new developments and advancements in the fields of biotechnology and medicine.

Recombinant Human CTPS2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CTPS2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products