Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human COPS8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99627
Molecular weight:
20.73 kDa

Original price was: €216.00.Current price is: €193.00.

50ug 11% OFF + 193 loyalty points
Met1–Lys166
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human COPS8 Protein, N-His

Product name ARO-P12071-100
Uniprot ID Q99627
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRK
Molecular weight 20.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys166
Aliases /Synonyms hCOP9, COPS8, COP9 signalosome complex subunit 8, COP9 homolog, Signalosome subunit 8, JAB1-containing signalosome subunit 8, SGN8, CSN8
Reference ARO-P12071
Note For research use only.
Molecular Constructor
Met1–Lys166
Product name ARO-P12071-1MG
Uniprot ID Q99627
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRK
Molecular weight 20.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys166
Aliases /Synonyms hCOP9, COPS8, COP9 signalosome complex subunit 8, COP9 homolog, Signalosome subunit 8, JAB1-containing signalosome subunit 8, SGN8, CSN8
Reference ARO-P12071
Note For research use only.
Molecular Constructor
Met1–Lys166
Product name ARO-P12071-50
Uniprot ID Q99627
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRK
Molecular weight 20.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys166
Aliases /Synonyms hCOP9, COPS8, COP9 signalosome complex subunit 8, COP9 homolog, Signalosome subunit 8, JAB1-containing signalosome subunit 8, SGN8, CSN8
Reference ARO-P12071
Note For research use only.
Molecular Constructor
Met1–Lys166

Introduction

Recombinant Human COPS8 Protein, also known as COP9 signalosome complex subunit 8, is a highly conserved protein that plays a crucial role in regulating cellular processes such as cell cycle progression, DNA repair, and protein degradation. This protein is a key component of the COP9 signalosome complex, which is involved in the ubiquitin-proteasome pathway, a major protein degradation pathway in cells. Recombinant Human COPS8 Protein is widely used in research and biotechnology applications due to its structural and functional properties.

Structure of Recombinant Human COPS8 Protein

Recombinant Human COPS8 Protein is a 32 kDa protein composed of 295 amino acids. It contains a highly conserved PCI (proteasome, COP9, eIF3) domain, which is essential for its function in the COP9 signalosome complex. This domain is composed of a series of repeated structural motifs that form a horseshoe-shaped structure. The PCI domain of Recombinant Human COPS8 Protein is responsible for protein-protein interactions and is involved in the assembly and stability of the COP9 signalosome complex.

In addition to the PCI domain, Recombinant Human COPS8 Protein also contains a coiled-coil domain, which is involved in protein-protein interactions and is essential for the formation of the COP9 signalosome complex. This domain is composed of two or more alpha-helices that wrap around each other, forming a superhelical structure. The coiled-coil domain of Recombinant Human COPS8 Protein is important for the stability and function of the COP9 signalosome complex.

Activity of Recombinant Human COPS8 Protein

Recombinant Human COPS8 Protein is a key component of the COP9 signalosome complex, which is responsible for regulating the activity of the ubiquitin-proteasome pathway. This pathway plays a critical role in the degradation of damaged or misfolded proteins, as well as the control of protein levels and activity in the cell. Recombinant Human COPS8 Protein is involved in the assembly and stability of the COP9 signalosome complex, which is required for the proper functioning of the ubiquitin-proteasome pathway.

Studies have shown that Recombinant Human COPS8 Protein is also involved in cell cycle progression and DNA repair. It has been found to interact with key proteins involved in these processes, suggesting a role in regulating their activity. Additionally, Recombinant Human COPS8 Protein has been linked to the regulation of cell growth and differentiation, further highlighting its importance in cellular processes.

Application of Recombinant Human COPS8 Protein

Recombinant Human COPS8 Protein is widely used in research and biotechnology applications due to its role in regulating cellular processes and its structural and functional properties. It is commonly used as an antigen in studies investigating the role of the COP9 signalosome complex in various cellular processes. Recombinant Human COPS8 Protein can also be used in protein-protein interaction studies to identify potential binding partners and further understand its role in cellular pathways.

In addition, Recombinant Human COPS8 Protein is used in drug discovery and development. As it is involved in regulating the activity of the ubiquitin-proteasome pathway, it is a potential target for therapeutic interventions in diseases where this pathway is dysregulated, such as cancer. Recombinant Human COPS8 Protein can also be used in the production of diagnostic assays for various diseases and conditions.

Conclusion

In summary, Recombinant Human COPS8 Protein is a highly conserved protein with a crucial role in regulating cellular processes such as cell cycle progression, DNA repair, and protein degradation. Its structural and functional properties make it a valuable tool in research and biotechnology applications. Further studies on this protein and its role in cellular pathways may lead to new therapeutic interventions and

Recombinant Human COPS8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human COPS8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products