Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human COPS8 Polyclonal Antibody

  • ARO-A12189-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Original price was: €143.00.Current price is: €118.00.

50ug 17% OFF + 118 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human COPS8 Polyclonal Antibody

Anti-Human COPS8 Polyclonal Antibody

Product name ARO-A12189-100
Uniprot ID Q99627
Raw Antigen Sequence MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRK
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-hCOP9, COPS8, COP9 signalosome complex subunit 8, COP9 homolog, Signalosome subunit 8, JAB1-containing signalosome subunit 8, SGN8, CSN8
Reference ARO-A12189
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human COPS8 (Met1-Lys166).
Product name ARO-A12189-1MG
Uniprot ID Q99627
Raw Antigen Sequence MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRK
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-hCOP9, COPS8, COP9 signalosome complex subunit 8, COP9 homolog, Signalosome subunit 8, JAB1-containing signalosome subunit 8, SGN8, CSN8
Reference ARO-A12189
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human COPS8 (Met1-Lys166).
Product name ARO-A12189-50
Uniprot ID Q99627
Raw Antigen Sequence MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRK
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-hCOP9, COPS8, COP9 signalosome complex subunit 8, COP9 homolog, Signalosome subunit 8, JAB1-containing signalosome subunit 8, SGN8, CSN8
Reference ARO-A12189
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human COPS8 (Met1-Lys166).

There are no reviews yet.

Be the first to review “Anti-Human COPS8 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products