Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CNRIP1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96F85
Molecular weight:
17.35 kDa

Original price was: €274.00.Current price is: €230.00.

50ug 16% OFF + 230 loyalty points
Gln34–Leu164
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CNRIP1, N-His

Product name ARO-P13181-100
Uniprot ID Q96F85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESF
Molecular weight 17.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln34-Leu164
Aliases /Synonyms CNRIP1, C2orf32, CB1 cannabinoid receptor-interacting protein 1, CRIP-1
Reference ARO-P13181
Note For research use only.
Molecular Constructor
Gln34–Leu164
Product name ARO-P13181-1MG
Uniprot ID Q96F85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESF
Molecular weight 17.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln34-Leu164
Aliases /Synonyms CNRIP1, C2orf32, CB1 cannabinoid receptor-interacting protein 1, CRIP-1
Reference ARO-P13181
Note For research use only.
Molecular Constructor
Gln34–Leu164
Product name ARO-P13181-50
Uniprot ID Q96F85
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESF
Molecular weight 17.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln34-Leu164
Aliases /Synonyms CNRIP1, C2orf32, CB1 cannabinoid receptor-interacting protein 1, CRIP-1
Reference ARO-P13181
Note For research use only.
Molecular Constructor
Gln34–Leu164

Introduction to Recombinant Human CNRIP1

Recombinant Human CNRIP1, also known as cannabinoid receptor interacting protein 1, is a protein that plays a crucial role in the endocannabinoid system. This protein is involved in the modulation of cannabinoid receptor signaling and has been identified as a potential therapeutic target for various diseases. In this article, we will explore the structure, activity, and potential applications of Recombinant Human CNRIP1.

Structure of Recombinant Human CNRIP1

Recombinant Human CNRIP1 is a 35 kDa protein that consists of 314 amino acids. It is encoded by the CNRIP1 gene located on chromosome 10 in humans. The protein contains several domains, including an N-terminal leucine zipper motif, a central coiled-coil domain, and a C-terminal proline-rich domain. These domains are important for the protein’s interaction with other proteins and its function in the endocannabinoid system.

Activity of Recombinant Human CNRIP1

Recombinant Human CNRIP1 is primarily known for its role in modulating cannabinoid receptor signaling. It has been shown to interact with both CB1 and CB2 receptors, which are the two main receptors of the endocannabinoid system. This interaction can either enhance or inhibit the activity of these receptors, depending on the specific cell type and signaling pathway involved.

In addition to its role in the endocannabinoid system, Recombinant Human CNRIP1 has also been found to interact with other proteins and play a role in various cellular processes. For example, it has been shown to interact with the voltage-gated potassium channel Kv4.2, which is involved in regulating neuronal excitability. This interaction may contribute to the protein’s role in modulating neuronal activity.

Potential Applications of Recombinant Human CNRIP1

Recombinant Human CNRIP1 has been identified as a potential therapeutic target for various diseases, including neurological disorders and cancer. Studies have shown that this protein is dysregulated in several neurological disorders, such as Alzheimer’s disease, Parkinson’s disease, and schizophrenia. Therefore, targeting CNRIP1 could potentially lead to the development of novel treatments for these conditions.

In addition, Recombinant Human CNRIP1 has been found to play a role in cancer progression. It has been shown to interact with the tumor suppressor protein p53, and its overexpression has been linked to increased cell proliferation and tumor growth. Therefore, targeting CNRIP1 could potentially be a promising strategy for cancer treatment.

Furthermore, Recombinant Human CNRIP1 has been studied as a potential biomarker for various diseases. Its expression has been found to be altered in several conditions, including obesity, diabetes, and cardiovascular diseases. This suggests that measuring CNRIP1 levels could be a useful diagnostic tool for these diseases.

Conclusion

Recombinant Human CNRIP1 is a 35 kDa protein that plays a crucial role in the endocannabinoid system. It interacts with cannabinoid receptors and other proteins, and its dysregulation has been linked to various diseases. Further research on this protein could potentially lead to the development of novel treatments and diagnostic tools for a range of disorders.

Recombinant Human CNRIP1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CNRIP1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products