Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CLN3 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13286
Molecular weight:
36.06 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Gln204–Val277
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CLN3 Protein, N-GST & C-His

Product name ARO-P11513-100
Uniprot ID Q13286
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWT
Molecular weight 36.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln204-Val277
Aliases /Synonyms BTS, Battenin, Batten disease protein, Protein CLN3, CLN3
Reference ARO-P11513
Note For research use only.
Molecular Constructor
Gln204–Val277
Product name ARO-P11513-1MG
Uniprot ID Q13286
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWT
Molecular weight 36.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln204-Val277
Aliases /Synonyms BTS, Battenin, Batten disease protein, Protein CLN3, CLN3
Reference ARO-P11513
Note For research use only.
Molecular Constructor
Gln204–Val277
Product name ARO-P11513-50
Uniprot ID Q13286
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWT
Molecular weight 36.06 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln204-Val277
Aliases /Synonyms BTS, Battenin, Batten disease protein, Protein CLN3, CLN3
Reference ARO-P11513
Note For research use only.
Molecular Constructor
Gln204–Val277

Introduction

Recombinant Human CLN3 protein is a type of protein that is produced through genetic engineering techniques. This protein is derived from the CLN3 gene, which is responsible for encoding a transmembrane protein found in the lysosomal membrane. The recombinant form of this protein has been extensively studied and is now used in various research and medical applications.

Structure of Recombinant Human CLN3 Protein

The recombinant form of CLN3 protein is a 438 amino acid long protein with a predicted molecular weight of 48 kDa. It contains a signal peptide at the N-terminus, which is responsible for its targeting and insertion into the lysosomal membrane. The protein also has six transmembrane domains, which are essential for its function as a transporter in the lysosome.

Activity of Recombinant Human CLN3 Protein

The primary function of CLN3 protein is to act as a transporter in the lysosome, a cellular organelle responsible for breaking down and recycling cellular waste products. The recombinant form of this protein has been shown to have similar activity to the natural form, indicating its potential as a therapeutic agent.

One of the key activities of CLN3 protein is its role in the transport of small molecules, such as amino acids and sugars, across the lysosomal membrane. This is essential for maintaining the proper balance of nutrients within the cell. In addition, CLN3 protein has been shown to play a role in the regulation of lysosomal pH, which is crucial for the proper functioning of lysosomal enzymes.

Application of Recombinant Human CLN3 Protein

Recombinant Human CLN3 protein has a wide range of applications in both research and medical fields. Some of the key applications of this protein are discussed below.

1. Research: CLN3 protein is extensively studied in the field of lysosomal storage disorders, particularly in the case of Batten disease, a rare genetic disorder caused by mutations in the CLN3 gene. The recombinant form of this protein is used to study its role in the disease and to develop potential treatments.

2. Drug development: The recombinant form of CLN3 protein can be used as a target for drug development in lysosomal storage disorders. By understanding the structure and activity of this protein, researchers can develop drugs that can modulate its function and potentially treat the disease.

3. Diagnostic tool: CLN3 protein is also used as a diagnostic tool for Batten disease. The recombinant form of this protein can be used in diagnostic tests to detect mutations in the CLN3 gene, which can aid in early diagnosis and treatment of the disease.

4. Therapeutic agent: The recombinant form of CLN3 protein has shown promising results as a potential therapeutic agent for Batten disease. Studies have shown that the protein can improve lysosomal function and reduce the accumulation of waste products in cells, which are key features of the disease.

5. Antigen for antibody production: Recombinant Human CLN3 protein can also be used as an antigen to produce antibodies that can specifically target this protein. These antibodies can be used in research and diagnostic applications, as well as in potential therapeutic treatments.

Conclusion

Recombinant Human CLN3 protein is a vital protein with various functions in the lysosome. Its structure and activity have been extensively studied, and the recombinant form of this protein has shown great potential in research and medical applications. With further research and development, this protein can potentially be used as a therapeutic agent for Batten disease and other lysosomal storage disorders.

Recombinant Human CLN3 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human CLN3 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products