Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CGGBP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UFW8
Molecular weight:
19.40 kDa

Original price was: €239.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Lys16–Cys167
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CGGBP1 Protein, N-His

Product name ARO-P12249-100
Uniprot ID Q9UFW8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Molecular weight 19.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys16-Cys167
Aliases /Synonyms CGGBP, 20 kDa CGG-binding protein, CGGBP1, CGG triplet repeat-binding protein 1, p20-CGGBP DNA-binding protein, CGG-binding protein 1
Reference ARO-P12249
Note For research use only.
Molecular Constructor
Lys16–Cys167
Product name ARO-P12249-1MG
Uniprot ID Q9UFW8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Molecular weight 19.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys16-Cys167
Aliases /Synonyms CGGBP, 20 kDa CGG-binding protein, CGGBP1, CGG triplet repeat-binding protein 1, p20-CGGBP DNA-binding protein, CGG-binding protein 1
Reference ARO-P12249
Note For research use only.
Molecular Constructor
Lys16–Cys167
Product name ARO-P12249-50
Uniprot ID Q9UFW8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Molecular weight 19.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys16-Cys167
Aliases /Synonyms CGGBP, 20 kDa CGG-binding protein, CGGBP1, CGG triplet repeat-binding protein 1, p20-CGGBP DNA-binding protein, CGG-binding protein 1
Reference ARO-P12249
Note For research use only.
Molecular Constructor
Lys16–Cys167

Introduction

The Recombinant Human CGGBP1 Protein is a highly purified protein that is produced through recombinant DNA technology. This protein is an important antigen that plays a crucial role in various cellular processes. In this article, we will discuss the structure, activity, and applications of this protein in detail.

Structure of Recombinant Human CGGBP1 Protein

The Recombinant Human CGGBP1 Protein is a 97 kDa protein that is composed of 855 amino acids. It is a member of the CGGBP family of proteins and is highly conserved among different species. The protein contains several functional domains, including a chromatin organization modifier (COM) domain and a DNA-binding domain. These domains are essential for its activity and function.

Activity of Recombinant Human CGGBP1 Protein

The Recombinant Human CGGBP1 Protein is a multifunctional protein that is involved in various cellular processes. Its main function is to regulate chromatin organization and gene expression. It binds to specific DNA sequences and acts as a transcription factor, controlling the expression of genes involved in cell growth, differentiation, and development.

Additionally, this protein has been found to interact with other cellular components, such as histones and other transcription factors, to modulate gene expression. It also plays a role in DNA repair and maintenance, making it an essential protein for maintaining genome stability.

Applications of Recombinant Human CGGBP1 Protein

The Recombinant Human CGGBP1 Protein has a wide range of applications in both research and medical fields. Some of the key applications of this protein are:

1. Gene Expression Studies

The Recombinant Human CGGBP1 Protein is widely used in gene expression studies to understand its role in regulating gene expression. Its ability to bind to specific DNA sequences and modulate gene expression makes it a valuable tool for studying various cellular processes.

2. Drug Development

Due to its involvement in various cellular processes, the Recombinant Human CGGBP1 Protein has potential applications in drug development. It is being studied as a potential target for cancer therapy, as its overexpression has been linked to various types of cancers.

3. Biomarker for Disease Diagnosis

The Recombinant Human CGGBP1 Protein has been found to be overexpressed in certain diseases, such as breast cancer and Alzheimer’s disease. This makes it a potential biomarker for disease diagnosis and prognosis.

4. Production of Antibodies

The Recombinant Human CGGBP1 Protein is an important antigen that can be used to produce antibodies. These antibodies can be used in various immunoassays, such as ELISA and Western blot, for the detection and quantification of the protein in biological samples.

5. Cell Biology Research

The Recombinant Human CGGBP1 Protein has been extensively studied in cell biology research. Its involvement in various cellular processes, such as chromatin organization and gene expression, makes it a valuable tool for understanding the mechanisms of cellular functions.

6. Potential Therapeutic Target

As mentioned earlier, the Recombinant Human CGGBP1 Protein has been linked to various diseases, making it a potential therapeutic target. Researchers are currently exploring its role in disease progression and developing targeted therapies to treat these diseases.

Conclusion

The Recombinant Human CGGBP1 Protein is a highly important protein that plays a crucial role in various cellular processes. Its structure, activity, and applications make it a valuable tool in research and medical fields. With ongoing studies and advancements in recombinant protein technology, the potential applications of this protein are only expected to increase in the future.

Recombinant Human CGGBP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CGGBP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products