Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CEP19 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96LK0
Molecular weight:
17.82 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Met1–Asp133
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CEP19 Protein, N-His

Product name ARO-P11169-100
Uniprot ID Q96LK0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDD
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp133
Aliases /Synonyms Centrosomal protein of 19 kDa, C3orf34, Cep19, CEP19
Reference ARO-P11169
Note For research use only.
Molecular Constructor
Met1–Asp133
Product name ARO-P11169-1MG
Uniprot ID Q96LK0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDD
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp133
Aliases /Synonyms Centrosomal protein of 19 kDa, C3orf34, Cep19, CEP19
Reference ARO-P11169
Note For research use only.
Molecular Constructor
Met1–Asp133
Product name ARO-P11169-50
Uniprot ID Q96LK0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDD
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp133
Aliases /Synonyms Centrosomal protein of 19 kDa, C3orf34, Cep19, CEP19
Reference ARO-P11169
Note For research use only.
Molecular Constructor
Met1–Asp133

Introduction

Recombinant Human CEP19 Protein, also known as centrosomal protein 19, is a protein that plays a crucial role in the formation and organization of the centrosome. The centrosome is a cellular organelle that is responsible for cell division and organization of the cytoskeleton. CEP19 is a key component of the centrosome and its dysfunction has been linked to various diseases such as cancer and ciliopathies. In this article, we will explore the structure, activity, and application of Recombinant Human CEP19 Protein.

Structure of Recombinant Human CEP19 Protein

CEP19 is a 19 kDa protein that is composed of 172 amino acids. It contains two coiled-coil domains, which are responsible for protein-protein interactions, and a C-terminal domain that is involved in centrosome localization. CEP19 also has a nuclear localization signal, indicating its ability to shuttle between the nucleus and the cytoplasm. The crystal structure of CEP19 has been determined, revealing its unique three-dimensional structure.

Activity of Recombinant Human CEP19 Protein

The main function of CEP19 is to regulate centrosome duplication and organization during cell division. It does so by interacting with other centrosomal proteins, such as CEP192 and CEP152, to form a stable complex at the centrosome. This complex is essential for the recruitment of other proteins involved in centrosome duplication and microtubule organization. Additionally, CEP19 has been shown to be involved in ciliogenesis, the process of forming cilia, which are hair-like structures that play important roles in cell signaling and movement.

Studies have also shown that CEP19 is essential for proper cell cycle progression. Knockdown of CEP19 leads to defects in cell division, resulting in abnormal cell proliferation and cell death. This highlights the crucial role of CEP19 in maintaining the integrity of the centrosome and ensuring proper cell division.

Application of Recombinant Human CEP19 Protein

Recombinant Human CEP19 Protein has a wide range of applications in both research and clinical settings. Its ability to regulate centrosome duplication and microtubule organization makes it a valuable tool for studying these cellular processes. Researchers can use recombinant CEP19 to investigate the role of this protein in various diseases and to understand its interactions with other centrosomal proteins.

Furthermore, the dysregulation of CEP19 has been implicated in several diseases, making it a potential therapeutic target. For instance, CEP19 has been shown to be overexpressed in certain types of cancer, including breast and lung cancer. Targeting CEP19 could potentially inhibit cancer cell growth and proliferation. Additionally, mutations in CEP19 have been linked to ciliopathies, which are genetic disorders affecting the structure and function of cilia. Recombinant CEP19 can be used to study the effects of these mutations and potentially develop treatments for ciliopathies.

Conclusion

In summary, Recombinant Human CEP19 Protein is a crucial component of the centrosome, playing a vital role in centrosome duplication, microtubule organization, and cell cycle progression. Its structure and activity have been extensively studied, and it has various applications in both research and clinical settings. Further research on CEP19 may lead to a better understanding of its role in diseases and the development of potential treatments.

Recombinant Human CEP19 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CEP19 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products