Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CDK9 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P50750
Molecular weight:
39.77 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Glu15–Ala340
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CDK9 Protein, N-His

Product name ARO-P10769-100
Uniprot ID P50750
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLA
Molecular weight 39.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Ala340
Aliases /Synonyms TAK, CDC2L4, C-2K, Cell division cycle 2-like protein kinase 4, Cell division protein kinase 9, Serine/threonine-protein kinase PITALRE, Cyclin-dependent kinase 9, CDK9, Tat-associated kinase complex catalytic subunit
Reference ARO-P10769
Note For research use only.
Molecular Constructor
Glu15–Ala340
Product name ARO-P10769-1MG
Uniprot ID P50750
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLA
Molecular weight 39.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Ala340
Aliases /Synonyms TAK, CDC2L4, C-2K, Cell division cycle 2-like protein kinase 4, Cell division protein kinase 9, Serine/threonine-protein kinase PITALRE, Cyclin-dependent kinase 9, CDK9, Tat-associated kinase complex catalytic subunit
Reference ARO-P10769
Note For research use only.
Molecular Constructor
Glu15–Ala340
Product name ARO-P10769-50
Uniprot ID P50750
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLA
Molecular weight 39.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Ala340
Aliases /Synonyms TAK, CDC2L4, C-2K, Cell division cycle 2-like protein kinase 4, Cell division protein kinase 9, Serine/threonine-protein kinase PITALRE, Cyclin-dependent kinase 9, CDK9, Tat-associated kinase complex catalytic subunit
Reference ARO-P10769
Note For research use only.
Molecular Constructor
Glu15–Ala340

Introduction

Recombinant Human CDK9 Protein, also known as Cyclin-Dependent Kinase 9, is a highly conserved protein that plays a crucial role in cell cycle regulation and transcriptional control. This protein is encoded by the CDK9 gene and is a member of the cyclin-dependent kinase family. Recombinant Human CDK9 Protein is produced through recombinant DNA technology and has a wide range of applications in both research and therapeutic fields.

Structure of Recombinant Human CDK9 Protein

Recombinant Human CDK9 Protein is a 42 kDa protein consisting of 372 amino acids. It is composed of three distinct domains: the N-terminal domain, the catalytic domain, and the C-terminal domain. The N-terminal domain is responsible for protein-protein interactions, while the catalytic domain contains the active site for kinase activity. The C-terminal domain is involved in substrate recognition and binding.

Activity of Recombinant Human CDK9 Protein

Recombinant Human CDK9 Protein is a serine/threonine kinase that plays a crucial role in regulating the cell cycle and transcriptional processes. It is a component of the positive transcription elongation factor b (P-TEFb) complex, which is essential for the elongation phase of transcription. CDK9 is activated by binding to its regulatory subunit, cyclin T, and phosphorylates the C-terminal domain of RNA polymerase II, leading to efficient transcriptional elongation.

Apart from its role in transcription, Recombinant Human CDK9 Protein also plays a critical role in cell cycle regulation. It phosphorylates the retinoblastoma protein (Rb), leading to its inactivation and allowing cells to progress from the G1 to the S phase of the cell cycle. CDK9 also regulates the expression of genes involved in cell survival and proliferation, making it a crucial player in various cellular processes.

Applications of Recombinant Human CDK9 Protein

Recombinant Human CDK9 Protein has a wide range of applications in both research and therapeutic fields. Some of the key applications of this protein are discussed below.

1. Research

Recombinant Human CDK9 Protein is widely used in research to study its role in transcription and cell cycle regulation. It is also used to investigate the mechanisms of action of various drugs that target CDK9, such as flavopiridol and dinaciclib. Additionally, CDK9 inhibitors are being studied for their potential anti-cancer effects, making Recombinant Human CDK9 Protein a valuable tool in cancer research.

2. Therapeutic Applications

CDK9 inhibitors have shown promising results in preclinical studies as potential anti-cancer agents. These inhibitors block the activity of Recombinant Human CDK9 Protein, leading to the inhibition of cancer cell growth. Clinical trials are currently underway to evaluate the efficacy of CDK9 inhibitors in treating various types of cancer, including leukemia, lymphoma, and solid tumors.

Apart from cancer, Recombinant Human CDK9 Protein has also shown potential in treating viral infections such as HIV and hepatitis B. CDK9 inhibitors have been shown to block viral replication by inhibiting the transcription of viral genes, making them a promising therapeutic option for these infections.

3. Diagnostic Applications

Recombinant Human CDK9 Protein can also be used as an antigen in diagnostic tests to detect the presence of antibodies against CDK9 in patient samples. This can be useful in diagnosing certain autoimmune diseases and monitoring the efficacy of CDK9 inhibitor therapy in cancer patients.

Conclusion

In conclusion, Recombinant Human CDK9 Protein is a crucial protein involved in cell cycle regulation and transcriptional control. Its structure, activity, and wide range of applications make it a valuable tool in both research and therapeutic fields. With ongoing research and clinical trials, Recombinant Human CDK9 Protein holds great promise for the development of

Recombinant Human CDK9 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CDK9 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products