Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CDCA4 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BXL8
Molecular weight:
22.79 kDa

Original price was: €237.00.Current price is: €193.00.

50ug 19% OFF + 193 loyalty points
Glu15–Gln108
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CDCA4 Protein, N-His-SUMO

Product name ARO-P11894-100
Uniprot ID Q9BXL8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAW
Molecular weight 22.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Gln108
Aliases /Synonyms HEPP, Cell division cycle-associated protein 4, CDCA4, Hematopoietic progenitor protein
Reference ARO-P11894
Note For research use only.
Molecular Constructor
Glu15–Gln108
Product name ARO-P11894-1MG
Uniprot ID Q9BXL8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAW
Molecular weight 22.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Gln108
Aliases /Synonyms HEPP, Cell division cycle-associated protein 4, CDCA4, Hematopoietic progenitor protein
Reference ARO-P11894
Note For research use only.
Molecular Constructor
Glu15–Gln108
Product name ARO-P11894-50
Uniprot ID Q9BXL8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAW
Molecular weight 22.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu15-Gln108
Aliases /Synonyms HEPP, Cell division cycle-associated protein 4, CDCA4, Hematopoietic progenitor protein
Reference ARO-P11894
Note For research use only.
Molecular Constructor
Glu15–Gln108

Introduction

Recombinant Human CDCA4 Protein, also known as cell division cycle-associated protein 4, is a protein that plays a crucial role in regulating cell division and proliferation. This protein is encoded by the CDCA4 gene and is highly conserved among different species, including humans.

Structure of Recombinant Human CDCA4 Protein

The Recombinant Human CDCA4 Protein is a 50 kDa protein consisting of 464 amino acids. It contains a conserved N-terminal domain and a C-terminal domain that is rich in proline and glutamine residues. The protein also has several phosphorylation sites, which are important for its activity.

Activity of Recombinant Human CDCA4 Protein

The main function of Recombinant Human CDCA4 Protein is to regulate cell division and proliferation. It does so by interacting with other proteins involved in cell cycle regulation, such as cyclin-dependent kinases (CDKs) and cyclins. This protein has been shown to be essential for proper cell division and is required for the accurate segregation of chromosomes during mitosis.

In addition to its role in cell division, Recombinant Human CDCA4 Protein has also been found to play a role in DNA repair. It interacts with other proteins involved in the DNA damage response, such as BRCA1 and BRCA2, and is thought to be involved in repairing double-strand breaks in DNA.

Application of Recombinant Human CDCA4 Protein

Recombinant Human CDCA4 Protein has a wide range of applications in both research and clinical settings. Some of the key applications include:

  • Cell cycle research: Recombinant Human CDCA4 Protein is commonly used in studies related to cell cycle regulation. Its role in regulating cell division makes it a valuable tool for understanding the mechanisms underlying cell division and proliferation.
  • Cancer research: Abnormal cell division is a hallmark of cancer, and Recombinant Human CDCA4 Protein has been found to be dysregulated in various types of cancer. Therefore, it is a potential target for cancer therapy and is also being studied as a biomarker for cancer diagnosis and prognosis.
  • Drug development: Given its crucial role in cell division, Recombinant Human CDCA4 Protein is a promising target for the development of novel anti-cancer drugs. By targeting this protein, it may be possible to inhibit cell division and prevent the growth of cancer cells.
  • Gene therapy: Recombinant Human CDCA4 Protein has also been used in gene therapy studies. By delivering the CDCA4 gene to cells, it may be possible to correct defects in cell division and restore normal cell function.

Conclusion

Recombinant Human CDCA4 Protein is a crucial protein involved in regulating cell division and proliferation. Its structure, activity, and applications make it a valuable tool for researchers studying cell cycle regulation, cancer, and other diseases. With further research, this protein may also have potential therapeutic applications in the treatment of various diseases.

Recombinant Human CDCA4 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CDCA4 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products