Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD169/SIGLEC1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BZZ2
Molecular weight:
25.76 kDa

Original price was: €260.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Gly34–Gly240
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD169/SIGLEC1, N-His

Product name ARO-P13124-100
Uniprot ID Q9BZZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSCLLIPCIFSFPADVEVPDGITAIWYYDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEISEVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYVCLQEQVRLQWQGQDPARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
Molecular weight 25.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly240
Aliases /Synonyms Siglec-1, CD169, SIGLEC1, SN, Sialic acid-binding Ig-like lectin 1, Sialoadhesin
Reference ARO-P13124
Note For research use only.
Molecular Constructor
Gly34–Gly240
Product name ARO-P13124-1MG
Uniprot ID Q9BZZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSCLLIPCIFSFPADVEVPDGITAIWYYDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEISEVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYVCLQEQVRLQWQGQDPARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
Molecular weight 25.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly240
Aliases /Synonyms Siglec-1, CD169, SIGLEC1, SN, Sialic acid-binding Ig-like lectin 1, Sialoadhesin
Reference ARO-P13124
Note For research use only.
Molecular Constructor
Gly34–Gly240
Product name ARO-P13124-50
Uniprot ID Q9BZZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GSCLLIPCIFSFPADVEVPDGITAIWYYDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEISEVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYVCLQEQVRLQWQGQDPARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
Molecular weight 25.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly240
Aliases /Synonyms Siglec-1, CD169, SIGLEC1, SN, Sialic acid-binding Ig-like lectin 1, Sialoadhesin
Reference ARO-P13124
Note For research use only.
Molecular Constructor
Gly34–Gly240

Introduction

Recombinant Human CD169/SIGLEC1 is a type I transmembrane protein that belongs to the sialic acid-binding Ig-like lectin (SIGLEC) family. It is also known as Sialoadhesin (Sn) and is encoded by the SIGLEC1 gene. CD169 is a cell surface receptor that is primarily expressed on macrophages and dendritic cells in the immune system. It has been shown to play a critical role in the recognition and clearance of pathogens, as well as in the regulation of immune responses.

Structure of Recombinant Human CD169/SIGLEC1

The recombinant form of CD169 is a glycosylated protein with a molecular weight of approximately 200 kDa. It is composed of an extracellular domain, a transmembrane region, and a cytoplasmic tail. The extracellular domain contains nine Ig-like domains, including a sialic acid-binding domain, which is responsible for the binding of CD169 to its ligands. The transmembrane region anchors the protein to the cell membrane, while the cytoplasmic tail contains signaling motifs that are important for the activation of downstream signaling pathways.

Activity of Recombinant Human CD169/SIGLEC1

CD169 is primarily known for its role in the recognition and uptake of pathogens by macrophages and dendritic cells. This is achieved through its ability to bind to sialylated glycans on the surface of pathogens, such as viruses and bacteria. This binding triggers the internalization of the pathogen into the cell, where it can be degraded and presented to other immune cells for recognition.

In addition to its role in pathogen recognition, CD169 has also been shown to play a role in the regulation of immune responses. It has been reported to act as a negative regulator of T cell activation by inducing the production of the anti-inflammatory cytokine IL-10. CD169 has also been shown to play a role in the maintenance of immune tolerance by promoting the development of regulatory T cells.

Application of Recombinant Human CD169/SIGLEC1

The recombinant form of CD169 has been widely used in research and clinical applications. One of its main applications is in the study of immune responses to pathogens. The ability of CD169 to bind to sialylated glycans on pathogens makes it a valuable tool for the isolation and characterization of these pathogens from complex samples.

Furthermore, the recombinant form of CD169 has also been used in the development of therapeutic strategies for the treatment of infectious diseases. By targeting CD169 on immune cells, researchers have been able to enhance the clearance of pathogens and improve immune responses.

Another potential application of recombinant CD169 is in the development of vaccines. By incorporating sialylated glycans into vaccine formulations, it is possible to target CD169 on immune cells and enhance the uptake and presentation of vaccine antigens, leading to a more robust immune response.

Conclusion

In summary, recombinant human CD169/SIGLEC1 is a glycosylated protein that plays a critical role in the recognition and clearance of pathogens, as well as in the regulation of immune responses. Its unique structure and activity make it a valuable tool in research and clinical applications, particularly in the study and treatment of infectious diseases. With ongoing research and development, the potential applications of recombinant CD169 are likely to expand, making it an important protein in the field of immunology.

Recombinant Human CD169/SIGLEC1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CD169/SIGLEC1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products