Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CBX5 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P45973
Molecular weight:
21.73 kDa

Original price was: €274.00.Current price is: €230.00.

50ug 16% OFF + 230 loyalty points
Gly2–Lys80
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CBX5 Protein, N-His-SUMO

Product name ARO-P12193-100
Uniprot ID P45973
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK
Molecular weight 21.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Lys80
Aliases /Synonyms Heterochromatin protein 1 homolog alpha, Chromobox protein homolog 5, HP1A, Antigen p25, HP1 alpha, CBX5
Reference ARO-P12193
Note For research use only.
Molecular Constructor
Gly2–Lys80
Product name ARO-P12193-1MG
Uniprot ID P45973
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK
Molecular weight 21.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Lys80
Aliases /Synonyms Heterochromatin protein 1 homolog alpha, Chromobox protein homolog 5, HP1A, Antigen p25, HP1 alpha, CBX5
Reference ARO-P12193
Note For research use only.
Molecular Constructor
Gly2–Lys80
Product name ARO-P12193-50
Uniprot ID P45973
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNK
Molecular weight 21.73 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly2-Lys80
Aliases /Synonyms Heterochromatin protein 1 homolog alpha, Chromobox protein homolog 5, HP1A, Antigen p25, HP1 alpha, CBX5
Reference ARO-P12193
Note For research use only.
Molecular Constructor
Gly2–Lys80

Overview

Recombinant Human CBX5 Protein, also known as Chromobox protein homolog 5, is a member of the chromobox (CBX) family of proteins. It is a highly conserved protein that plays a crucial role in epigenetic regulation and gene expression. This protein is expressed in various tissues and has been found to be involved in a wide range of cellular processes, including cell proliferation, differentiation, and apoptosis. In this article, we will explore the structure, activity, and applications of Recombinant Human CBX5 Protein.

Structure of Recombinant Human CBX5 Protein

Recombinant Human CBX5 Protein is a 170 amino acid protein with a molecular weight of approximately 19 kDa. It contains a chromodomain, a chromobox (CBX) domain, and a nuclear localization signal (NLS). The chromodomain is responsible for binding to histone proteins, while the CBX domain is involved in protein-protein interactions. The NLS allows the protein to enter the nucleus and bind to DNA.

Activity of Recombinant Human CBX5 Protein

The main activity of Recombinant Human CBX5 Protein is its ability to bind to histone proteins and regulate gene expression. It specifically binds to histone H3 trimethylated at lysine 9 (H3K9me3), which is a mark of heterochromatin. This binding results in the compaction of chromatin and silencing of gene expression. Recombinant Human CBX5 Protein has also been found to interact with other proteins involved in epigenetic regulation, such as DNA methyltransferases and histone deacetylases.

Applications of Recombinant Human CBX5 Protein

1. Epigenetic Research: Recombinant Human CBX5 Protein is a valuable tool for studying epigenetic mechanisms. Its ability to bind to specific histone modifications allows researchers to investigate the role of these modifications in gene regulation and cellular processes.

2. Cancer Research: Dysregulation of CBX5 expression has been observed in various types of cancer, making it a potential target for cancer therapies. Recombinant Human CBX5 Protein can be used to study its role in cancer development and as a potential therapeutic target.

3. Drug Discovery: Recombinant Human CBX5 Protein has been used in drug screening assays to identify compounds that can modulate its activity. This can lead to the development of novel drugs for various diseases, including cancer and neurodegenerative disorders.

4. Diagnostic Tool: CBX5 has been shown to be overexpressed in certain types of cancer, making it a potential biomarker for early detection and diagnosis. Recombinant Human CBX5 Protein can be used in diagnostic assays to measure its levels in patient samples.

5. Therapeutic Agent: Recombinant Human CBX5 Protein has been investigated as a potential therapeutic agent for diseases such as cancer and viral infections. Its ability to regulate gene expression and interact with other epigenetic regulators makes it a promising candidate for future therapies.

Conclusion

In conclusion, Recombinant Human CBX5 Protein is a highly versatile protein with crucial roles in epigenetic regulation and gene expression. Its structure, activity, and applications make it a valuable tool for various fields of research and potential therapeutic applications. Further studies on this protein may lead to a better understanding of its functions and potential for the development of novel treatments for various diseases.

Recombinant Human CBX5 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CBX5 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products