Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CASP6, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P55212
Molecular weight:
13.60 kDa

Original price was: €258.00.Current price is: €230.00.

50ug 11% OFF + 230 loyalty points
His Ala194–Asn293
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CASP6, N-His

Product name ARO-P13615-100
Uniprot ID P55212
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Molecular weight 13.60 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala194-Asn293
Aliases /Synonyms Apoptotic protease Mch-2, Caspase-6, CASP-6, MCH2, CASP6
Reference ARO-P13615
Note For research use only.
Molecular Constructor
His Ala194–Asn293
Product name ARO-P13615-1MG
Uniprot ID P55212
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Molecular weight 13.60 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala194-Asn293
Aliases /Synonyms Apoptotic protease Mch-2, Caspase-6, CASP-6, MCH2, CASP6
Reference ARO-P13615
Note For research use only.
Molecular Constructor
His Ala194–Asn293
Product name ARO-P13615-50
Uniprot ID P55212
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN
Molecular weight 13.60 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala194-Asn293
Aliases /Synonyms Apoptotic protease Mch-2, Caspase-6, CASP-6, MCH2, CASP6
Reference ARO-P13615
Note For research use only.
Molecular Constructor
His Ala194–Asn293

Introduction

Recombinant proteins have become an essential tool in various fields of science, including medicine, biotechnology, and research. One such recombinant protein is Recombinant Human CASP6, which has gained significant attention due to its structure, activity, and potential applications. In this article, we will delve into the details of this protein and explore its role in various scientific fields.

Structure of Recombinant Human CASP6

Recombinant Human CASP6, also known as Caspase 6, is a member of the caspase family of cysteine proteases. It is encoded by the CASP6 gene located on chromosome 4 in humans. The protein is composed of 303 amino acids and has a molecular weight of approximately 35 kDa. It contains a prodomain, a large subunit, and a small subunit, which are essential for its activity.

Activity of Recombinant Human CASP6

Recombinant Human CASP6 is primarily involved in the process of apoptosis, also known as programmed cell death. It plays a crucial role in the cleavage of various cellular substrates, leading to the activation of apoptosis. This protein is activated by proteolytic cleavage, which results in the formation of active caspase-6. Once activated, it can cleave various cellular proteins, including lamin A, fodrin, and alpha-spectrin, leading to the breakdown of the cell. Moreover, caspase-6 has also been found to play a role in neurodegenerative diseases, such as Alzheimer’s and Huntington’s disease, by cleaving specific proteins involved in these conditions.

Application of Recombinant Human CASP6

The unique structure and activity of Recombinant Human CASP6 make it a valuable tool in various scientific applications. One of its primary uses is in drug discovery and development. As caspase-6 is involved in apoptosis, it has been targeted as a potential therapeutic target for various diseases, including cancer. Recombinant Human CASP6 has also been used in research to study the mechanism of apoptosis and the role of caspase-6 in different cellular pathways. Additionally, this protein has been used in diagnostic assays to detect the activity of caspase-6 in various diseases, making it a potential biomarker for certain conditions.

Conclusion

In summary, Recombinant Human CASP6 is a recombinant protein with a crucial role in apoptosis and potential applications in various scientific fields. Its unique structure and activity make it a valuable tool for drug discovery, research, and diagnostics. As more studies are conducted on this protein, its potential in different areas of science is likely to increase, making it an essential protein in the scientific community.

Recombinant Human CASP6, N-His

There are no reviews yet.

Be the first to review “Recombinant Human CASP6, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products