Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CABYR Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75952
Molecular weight:
35.16 kDa

Original price was: €234.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Gly13–Gly73
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CABYR Protein, N-GST & C-His

Product name ARO-P11355-100
Uniprot ID O75952
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEG
Molecular weight 35.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly13-Gly73
Aliases /Synonyms Calcium-binding protein 86, Testis-specific calcium-binding protein CBP86, FSP2, Calcium-binding tyrosine phosphorylation-regulated protein, CBP86, Cancer/testis antigen 88, CT88, CABYR, Fibrousheathin II, FSP-2, Fibrousheathin-2
Reference ARO-P11355
Note For research use only.
Molecular Constructor
Gly13–Gly73
Product name ARO-P11355-1MG
Uniprot ID O75952
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEG
Molecular weight 35.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly13-Gly73
Aliases /Synonyms Calcium-binding protein 86, Testis-specific calcium-binding protein CBP86, FSP2, Calcium-binding tyrosine phosphorylation-regulated protein, CBP86, Cancer/testis antigen 88, CT88, CABYR, Fibrousheathin II, FSP-2, Fibrousheathin-2
Reference ARO-P11355
Note For research use only.
Molecular Constructor
Gly13–Gly73
Product name ARO-P11355-50
Uniprot ID O75952
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEG
Molecular weight 35.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly13-Gly73
Aliases /Synonyms Calcium-binding protein 86, Testis-specific calcium-binding protein CBP86, FSP2, Calcium-binding tyrosine phosphorylation-regulated protein, CBP86, Cancer/testis antigen 88, CT88, CABYR, Fibrousheathin II, FSP-2, Fibrousheathin-2
Reference ARO-P11355
Note For research use only.
Molecular Constructor
Gly13–Gly73

Introduction

Recombinant Human CABYR Protein, also known as Calcium-binding tyrosine phosphorylation-regulated protein, is a protein that is encoded by the CABYR gene. This protein is highly conserved among mammalian species and plays a crucial role in various cellular processes such as signal transduction, cell cycle regulation, and protein phosphorylation. In this article, we will discuss the structure, activity, and applications of Recombinant Human CABYR Protein.

Structure of Recombinant Human CABYR Protein

Recombinant Human CABYR Protein is a 31 kDa protein consisting of 259 amino acids. It contains a calcium-binding EF-hand domain, a tyrosine phosphorylation site, and a leucine zipper motif. The EF-hand domain is responsible for binding to calcium ions and plays a crucial role in regulating the protein’s activity. The tyrosine phosphorylation site is essential for the protein’s activation, and the leucine zipper motif is involved in protein-protein interactions.

Activity of Recombinant Human CABYR Protein

Recombinant Human CABYR Protein is a multifunctional protein that is involved in various cellular processes. It is primarily known for its role in signal transduction, where it acts as a mediator between extracellular signals and intracellular responses. The calcium-binding EF-hand domain of CABYR allows it to sense changes in the calcium concentration and activate downstream signaling pathways. This protein also plays a crucial role in cell cycle regulation by interacting with cyclin-dependent kinases and regulating their activity. Furthermore, Recombinant Human CABYR Protein has been shown to be involved in protein phosphorylation, which is essential for many cellular processes, including cell growth and differentiation.

Applications of Recombinant Human CABYR Protein

Recombinant Human CABYR Protein has several potential applications in the field of medicine and biotechnology. One of the primary applications of this protein is its use as an antigen for diagnostic and therapeutic purposes. Antibodies against CABYR have been identified in patients with various types of cancer, including lung, breast, and prostate cancer. Therefore, Recombinant Human CABYR Protein can be used as a biomarker for cancer diagnosis and monitoring.

Moreover, studies have shown that Recombinant Human CABYR Protein is overexpressed in cancer cells, making it a potential target for cancer therapy. Inhibitors of CABYR have been developed, which can potentially inhibit its activity and slow down the growth of cancer cells. This protein has also been shown to be involved in the development of drug resistance in cancer cells, making it a promising target for overcoming drug resistance.

In addition to its role in cancer, Recombinant Human CABYR Protein has also been implicated in other diseases and conditions. For instance, it has been found to be associated with male infertility, where its expression is significantly reduced in infertile men compared to fertile men. This protein has also been linked to neurodegenerative diseases, such as Alzheimer’s and Parkinson’s disease, where it may play a role in the progression of these diseases.

Conclusion

In summary, Recombinant Human CABYR Protein is a multifunctional protein that plays a crucial role in various cellular processes. Its structure, which includes a calcium-binding EF-hand domain, a tyrosine phosphorylation site, and a leucine zipper motif, allows it to perform its diverse functions. This protein has several potential applications in the field of medicine and biotechnology, including its use as an antigen for diagnostic and therapeutic purposes and as a target for cancer therapy. Further research on this protein may uncover more potential applications and shed light on its role in various diseases and conditions.

Recombinant Human CABYR Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human CABYR Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products