Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATP5ME Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P56385
Molecular weight:
20.14 kDa

Original price was: €262.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Val2–Lys69
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATP5ME Protein, N-His-SUMO

Product name ARO-P10770-100
Uniprot ID P56385
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Molecular weight 20.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2-Lys69
Aliases /Synonyms ATP5K, ATP5ME, ATPase subunit e, ATP synthase subunit e, mitochondrial, ATP synthase membrane subunit e, ATP5I
Reference ARO-P10770
Note For research use only.
Molecular Constructor
Val2–Lys69
Product name ARO-P10770-1MG
Uniprot ID P56385
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Molecular weight 20.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2-Lys69
Aliases /Synonyms ATP5K, ATP5ME, ATPase subunit e, ATP synthase subunit e, mitochondrial, ATP synthase membrane subunit e, ATP5I
Reference ARO-P10770
Note For research use only.
Molecular Constructor
Val2–Lys69
Product name ARO-P10770-50
Uniprot ID P56385
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Molecular weight 20.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2-Lys69
Aliases /Synonyms ATP5K, ATP5ME, ATPase subunit e, ATP synthase subunit e, mitochondrial, ATP synthase membrane subunit e, ATP5I
Reference ARO-P10770
Note For research use only.
Molecular Constructor
Val2–Lys69

Introduction:

Recombinant Human ATP5ME Protein is a key enzyme that plays a crucial role in the production of cellular energy in the form of ATP. This protein is encoded by the ATP5ME gene and is a member of the ATP synthase family. It is also known as the mitochondrial ATP synthase membrane subunit e (ATP5ME). In this article, we will discuss the structure, activity, and application of Recombinant Human ATP5ME Protein.

Structure:

The ATP5ME gene is located on chromosome 15 in humans and is composed of 6 exons that span over 12 kb. The protein is composed of 50 amino acids with a molecular weight of 5.5 kDa. It is a subunit of the ATP synthase complex, which is a large, multi-subunit enzyme that is responsible for the synthesis of ATP from ADP and inorganic phosphate. The ATP5ME protein is a transmembrane protein that is located in the inner mitochondrial membrane.

Activity:

The ATP5ME protein is an essential component of the ATP synthase complex, which is responsible for the production of ATP in the mitochondria. This protein plays a crucial role in the final step of ATP synthesis, where it helps in the conversion of ADP to ATP. It does so by forming a channel that allows the passage of protons across the inner mitochondrial membrane, which is necessary for the production of ATP. This process is known as oxidative phosphorylation and is the primary source of cellular energy in eukaryotic cells.

Application:

Recombinant Human ATP5ME Protein has a wide range of applications in various fields of research and medicine. Some of the major applications are listed below:

1. Recombinant Human ATP5ME Protein as a recombinant protein:

Recombinant Human ATP5ME Protein is widely used as a recombinant protein in various research studies. It is produced by cloning the ATP5ME gene into an expression vector and then expressing it in a suitable host system such as E. coli or yeast. The recombinant protein can then be purified and used for various biochemical and biophysical studies to understand its structure and function.

2. Recombinant Human ATP5ME Protein as an antigen:

Recombinant Human ATP5ME Protein has also been used as an antigen in various immunological studies. It has been shown to elicit a strong immune response and can be used for the production of specific antibodies against the protein. These antibodies can then be used for various applications such as western blotting, immunohistochemistry, and flow cytometry.

3. Recombinant Human ATP5ME Protein in mitochondrial diseases:

Mutations in the ATP5ME gene have been linked to various mitochondrial diseases such as Leigh syndrome and mitochondrial complex V deficiency. Recombinant Human ATP5ME Protein has been used in research studies to understand the role of these mutations in the development of these diseases. It has also been used to develop potential treatments for these diseases.

4. Recombinant Human ATP5ME Protein in cancer research:

The ATP5ME gene has been found to be overexpressed in various types of cancer, including breast cancer and lung cancer. Recombinant Human ATP5ME Protein has been used in cancer research to study its role in tumor growth and development. It has also been explored as a potential target for cancer therapy.

Conclusion:

Recombinant Human ATP5ME Protein is a vital enzyme that is involved in the production of cellular energy in the form of ATP. It is a transmembrane protein that is a subunit of the ATP synthase complex. The protein has a wide range of applications in various fields of research and medicine, including as a recombinant protein, antigen, and in the study of mitochondrial diseases and cancer. Further research on this protein may lead to a better understanding of its role in cellular energy production and potential therapeutic applications.

Recombinant Human ATP5ME Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human ATP5ME Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products