Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARHGDIB Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52566
Molecular weight:
17.92 kDa

Original price was: €385.00.Current price is: €329.00.

100ug 15% OFF + 329 loyalty points
Asn66–Glu201
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARHGDIB Protein, N-His

Product name ARO-P11315-100
Uniprot ID P52566
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Molecular weight 17.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn66-Glu201
Aliases /Synonyms ARHGDIB, Rho-GDI beta, Rho GDP-dissociation inhibitor 2, RAP1GN1, Rho GDI 2, GDIA2, GDID4, Ly-GDI
Reference ARO-P11315
Note For research use only.
Molecular Constructor
Asn66–Glu201
Product name ARO-P11315-1MG
Uniprot ID P52566
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Molecular weight 17.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn66-Glu201
Aliases /Synonyms ARHGDIB, Rho-GDI beta, Rho GDP-dissociation inhibitor 2, RAP1GN1, Rho GDI 2, GDIA2, GDID4, Ly-GDI
Reference ARO-P11315
Note For research use only.
Molecular Constructor
Asn66–Glu201
Product name ARO-P11315-50
Uniprot ID P52566
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Molecular weight 17.92 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn66-Glu201
Aliases /Synonyms ARHGDIB, Rho-GDI beta, Rho GDP-dissociation inhibitor 2, RAP1GN1, Rho GDI 2, GDIA2, GDID4, Ly-GDI
Reference ARO-P11315
Note For research use only.
Molecular Constructor
Asn66–Glu201

Introduction

Recombinant Human ARHGDIB Protein, also known as Rho GDP-dissociation inhibitor 2 (RhoGDI2), is a protein that plays a critical role in regulating the activity of Rho GTPases. Rho GTPases are a family of signaling proteins that control various cellular processes, such as cell migration, proliferation, and differentiation. Dysregulation of Rho GTPase activity has been linked to various diseases, making ARHGDIB an important target for research and potential therapeutic applications.

Structure of Recombinant Human ARHGDIB Protein

The ARHGDIB gene encodes for a protein consisting of 204 amino acids with a molecular weight of approximately 23 kDa. The recombinant protein is produced in a laboratory setting using genetic engineering techniques, resulting in a highly pure and homogeneous protein. The protein is composed of two domains: an N-terminal RhoGDI domain and a C-terminal RhoGDI-binding domain. These domains are responsible for the protein’s ability to interact with and regulate the activity of Rho GTPases.

Activity of Recombinant Human ARHGDIB Protein

The primary function of ARHGDIB is to inhibit the activity of Rho GTPases by binding to and sequestering them in the cytoplasm. This prevents the GTPases from interacting with their downstream effectors and carrying out their signaling functions. ARHGDIB has been shown to specifically interact with RhoA, RhoB, and RhoC, as well as other members of the Rho family, such as Rac1 and Cdc42.

In addition to its inhibitory role, ARHGDIB has also been found to have a regulatory effect on Rho GTPase activation. Studies have shown that ARHGDIB can modulate the GTPase activity of RhoA by promoting its activation or inactivation, depending on the cellular context. This highlights the complex and dynamic nature of ARHGDIB’s role in regulating Rho GTPase signaling.

Applications of Recombinant Human ARHGDIB Protein

The ability of ARHGDIB to regulate Rho GTPase activity makes it a valuable tool in various research fields, including cancer, cardiovascular disease, and neurological disorders. For example, ARHGDIB has been found to be downregulated in certain types of cancer, leading to increased Rho GTPase activity and promoting tumor growth and metastasis. By studying the effects of ARHGDIB on Rho GTPase activity, researchers can gain a better understanding of the mechanisms underlying cancer progression and potentially identify new therapeutic targets.

In addition to its role in disease research, ARHGDIB has also been investigated for its potential therapeutic applications. Studies have shown that recombinant ARHGDIB protein can inhibit Rho GTPase activity and suppress tumor growth in animal models, making it a promising candidate for cancer treatment. Furthermore, ARHGDIB has been found to have a protective effect on the cardiovascular system by inhibiting Rho GTPase-mediated inflammation and promoting vascular stability.

Conclusion

In summary, Recombinant Human ARHGDIB Protein is a highly pure and homogeneous protein that plays a critical role in regulating the activity of Rho GTPases. Its ability to inhibit and regulate Rho GTPase activity makes it a valuable tool in various research fields and a potential therapeutic target for diseases associated with dysregulated Rho GTPase signaling. Further studies on the structure, activity, and applications of ARHGDIB will continue to advance our understanding of its role in cellular processes and its potential as a therapeutic agent.

Recombinant Human ARHGDIB Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARHGDIB Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products