Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human MAPK11, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15759
Molecular weight:
34.38 kDa

Original price was: €274.00.Current price is: €230.00.

50ug 16% OFF + 230 loyalty points
Leu24–Phe308
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human MAPK11, N-His

Recombinant Human MAPK11, N-His

Product name ARO-P13352-100
Uniprot ID Q15759
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYF
Molecular weight 34.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu24-Phe308
Aliases /Synonyms MAP kinase 11, Mitogen-activated protein kinase p38 beta, MAPK 11, Mitogen-activated protein kinase 11, PRKM11, SAPK2B, Stress-activated protein kinase 2b, MAP kinase p38 beta, MAPK11, p38b, p38-2, SAPK2, SAPK2b
Reference ARO-P13352
Note For research use only.
Molecular Constructor
Leu24–Phe308
Product name ARO-P13352-1MG
Uniprot ID Q15759
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYF
Molecular weight 34.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu24-Phe308
Aliases /Synonyms MAP kinase 11, Mitogen-activated protein kinase p38 beta, MAPK 11, Mitogen-activated protein kinase 11, PRKM11, SAPK2B, Stress-activated protein kinase 2b, MAP kinase p38 beta, MAPK11, p38b, p38-2, SAPK2, SAPK2b
Reference ARO-P13352
Note For research use only.
Molecular Constructor
Leu24–Phe308
Product name ARO-P13352-50
Uniprot ID Q15759
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYF
Molecular weight 34.38 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu24-Phe308
Aliases /Synonyms MAP kinase 11, Mitogen-activated protein kinase p38 beta, MAPK 11, Mitogen-activated protein kinase 11, PRKM11, SAPK2B, Stress-activated protein kinase 2b, MAP kinase p38 beta, MAPK11, p38b, p38-2, SAPK2, SAPK2b
Reference ARO-P13352
Note For research use only.
Molecular Constructor
Leu24–Phe308

Recombinant Human MAPK11, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MAPK11, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products