Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARHGAP5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13017
Molecular weight:
29.09 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points
Ser12–Lys248
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARHGAP5 Protein, N-His

Product name ARO-P11621-100
Uniprot ID Q13017
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTIDFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFTALVQMLDK
Molecular weight 29.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser12-Lys248
Aliases /Synonyms Rho-type GTPase-activating protein 5, ARHGAP5, RHOGAP5, p190-B, Rho GTPase-activating protein 5
Reference ARO-P11621
Note For research use only.
Molecular Constructor
Ser12–Lys248
Product name ARO-P11621-1MG
Uniprot ID Q13017
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTIDFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFTALVQMLDK
Molecular weight 29.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser12-Lys248
Aliases /Synonyms Rho-type GTPase-activating protein 5, ARHGAP5, RHOGAP5, p190-B, Rho GTPase-activating protein 5
Reference ARO-P11621
Note For research use only.
Molecular Constructor
Ser12–Lys248
Product name ARO-P11621-50
Uniprot ID Q13017
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTIDFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFTALVQMLDK
Molecular weight 29.09 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser12-Lys248
Aliases /Synonyms Rho-type GTPase-activating protein 5, ARHGAP5, RHOGAP5, p190-B, Rho GTPase-activating protein 5
Reference ARO-P11621
Note For research use only.
Molecular Constructor
Ser12–Lys248

Introduction to Recombinant Human ARHGAP5 Protein

Recombinant Human ARHGAP5 Protein, also known as Rho GTPase-activating protein 5, is a protein that plays a crucial role in regulating the activity of Rho family GTPases. These GTPases are essential for various cellular processes such as cell migration, proliferation, and differentiation. The ARHGAP5 protein is involved in the inactivation of Rho GTPases, thereby controlling their signaling pathways and ultimately affecting cell behavior.

Structure of Recombinant Human ARHGAP5 Protein

The recombinant human ARHGAP5 protein is a 120 kDa protein composed of 1083 amino acids. It contains a central RhoGAP domain, which is responsible for its GTPase-activating function. This domain is flanked by an N-terminal SH3 domain and a C-terminal PH domain, both of which are involved in protein-protein interactions. The SH3 domain binds to proline-rich motifs in other proteins, while the PH domain interacts with phospholipids in the cell membrane.

The protein also contains a C-terminal coiled-coil domain, which is responsible for its dimerization. This dimerization is essential for the protein’s function as it allows for the formation of a stable complex with its target Rho GTPases.

Activity of Recombinant Human ARHGAP5 Protein

The main activity of recombinant human ARHGAP5 protein is its GTPase-activating function. This protein binds to and stimulates the intrinsic GTPase activity of Rho GTPases, leading to their inactivation. This activity is crucial for regulating the activity of Rho GTPases, as their overactivation can lead to various diseases, including cancer and neurological disorders.

Additionally, the ARHGAP5 protein also plays a role in cell adhesion and migration. It interacts with components of the cell adhesion complex, such as vinculin and paxillin, and regulates their activity. This, in turn, affects the dynamics of the actin cytoskeleton, which is essential for cell movement and migration.

Application of Recombinant Human ARHGAP5 Protein

The recombinant human ARHGAP5 protein has various applications in both research and clinical settings. Its role in regulating Rho GTPases makes it a valuable tool for studying the signaling pathways involved in cell migration, proliferation, and differentiation. Researchers can use this protein to manipulate the activity of Rho GTPases and study their effects on cellular processes.

In a clinical setting, the ARHGAP5 protein has potential as a therapeutic target for diseases caused by dysregulated Rho GTPase signaling. By inhibiting the activity of this protein, it may be possible to prevent the overactivation of Rho GTPases and treat diseases such as cancer and neurological disorders.

Moreover, the ARHGAP5 protein has also been linked to various human diseases, including Alzheimer’s disease and Parkinson’s disease. By studying its role in these diseases, researchers may gain a better understanding of their underlying mechanisms and develop potential treatments.

Conclusion

Recombinant Human ARHGAP5 Protein is a crucial protein involved in regulating the activity of Rho family GTPases. Its structure, activity, and applications make it a valuable tool in both research and clinical settings. With further studies, this protein may hold the key to understanding and treating various human diseases.

Recombinant Human ARHGAP5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARHGAP5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products