Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARHGAP10 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
A1A4S6
Molecular weight:
23.23 kDa

Original price was: €281.00.Current price is: €230.00.

50ug 18% OFF + 230 loyalty points
Asp392–Thr576
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARHGAP10 Protein, N-His

Product name ARO-P11605-100
Uniprot ID A1A4S6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DKMGFTIIRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRT
Molecular weight 23.23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp392-Thr576
Aliases /Synonyms Graf-related protein 2, GTPase regulator associated with focal adhesion kinase 2, ARHGAP10, GRAF2, Rho GTPase-activating protein 10, Rho-type GTPase-activating protein 10
Reference ARO-P11605
Note For research use only.
Molecular Constructor
Asp392–Thr576
Product name ARO-P11605-1MG
Uniprot ID A1A4S6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DKMGFTIIRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRT
Molecular weight 23.23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp392-Thr576
Aliases /Synonyms Graf-related protein 2, GTPase regulator associated with focal adhesion kinase 2, ARHGAP10, GRAF2, Rho GTPase-activating protein 10, Rho-type GTPase-activating protein 10
Reference ARO-P11605
Note For research use only.
Molecular Constructor
Asp392–Thr576
Product name ARO-P11605-50
Uniprot ID A1A4S6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DKMGFTIIRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRT
Molecular weight 23.23 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp392-Thr576
Aliases /Synonyms Graf-related protein 2, GTPase regulator associated with focal adhesion kinase 2, ARHGAP10, GRAF2, Rho GTPase-activating protein 10, Rho-type GTPase-activating protein 10
Reference ARO-P11605
Note For research use only.
Molecular Constructor
Asp392–Thr576

Introduction to Recombinant Human ARHGAP10 Protein

Recombinant Human ARHGAP10 Protein, also known as Rho GTPase-activating protein 10, is a protein that plays a crucial role in regulating the activity of Rho family GTPases. These GTPases are essential for various cellular processes, including cell migration, cell adhesion, and cell division. The ARHGAP10 protein is involved in the inactivation of Rho GTPases, thereby controlling their signaling pathways and ultimately affecting cellular behavior.

Structure of Recombinant Human ARHGAP10 Protein

The ARHGAP10 protein is a 101 kDa protein composed of 923 amino acids. It consists of a central Rho GTPase-activating protein (GAP) domain, which is responsible for the inactivation of Rho GTPases. This domain is flanked by an N-terminal BAR (Bin-Amphiphysin-Rvs) domain and a C-terminal SH3 (Src Homology 3) domain. These domains are involved in protein-protein interactions and play a crucial role in the regulation of ARHGAP10 activity.

The BAR domain is responsible for membrane binding and curvature sensing, whereas the SH3 domain is involved in protein-protein interactions, particularly with Rho GTPases. The presence of these domains in the ARHGAP10 protein highlights its role in modulating the activity of Rho GTPases at the cell membrane.

Activity of Recombinant Human ARHGAP10 Protein

The main function of ARHGAP10 protein is to inactivate Rho GTPases by stimulating their intrinsic GTPase activity. Rho GTPases are molecular switches that cycle between an active GTP-bound state and an inactive GDP-bound state. The ARHGAP10 protein binds to the active GTP-bound form of Rho GTPases and accelerates the hydrolysis of GTP to GDP, leading to the inactivation of the GTPase.

By inactivating Rho GTPases, ARHGAP10 controls their signaling pathways and affects various cellular processes. For example, the inactivation of Rho GTPases by ARHGAP10 can lead to changes in actin cytoskeleton dynamics, affecting cell migration and adhesion. It can also regulate cell division by affecting the formation of the contractile ring during cytokinesis.

Application of Recombinant Human ARHGAP10 Protein

The activity of ARHGAP10 protein in regulating Rho GTPases makes it a crucial player in various cellular processes. Its dysregulation has been linked to various diseases, including cancer, cardiovascular diseases, and neurological disorders. Therefore, the use of recombinant ARHGAP10 protein has emerged as a potential therapeutic approach to target these diseases.

One of the main applications of recombinant ARHGAP10 protein is in cancer treatment. The overactivation of Rho GTPases has been observed in many types of cancer, leading to increased cell migration and invasion. By inactivating these GTPases, ARHGAP10 protein can potentially inhibit cancer cell metastasis. Additionally, the use of ARHGAP10 protein has also been studied in the treatment of cardiovascular diseases, such as atherosclerosis, as it can regulate the migration and proliferation of smooth muscle cells.

Furthermore, the role of ARHGAP10 protein in regulating neuronal development and synaptic plasticity has also been explored. It has been shown to play a crucial role in the formation and maintenance of dendritic spines, which are essential for proper neuronal function. Therefore, recombinant ARHGAP10 protein has the potential to be used in the treatment of neurological disorders, such as Alzheimer’s disease and autism spectrum disorders.

Conclusion

In summary, Recombinant Human ARHGAP10 Protein is a 101 kDa protein composed of three domains that play a

Recombinant Human ARHGAP10 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARHGAP10 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products