Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AMIGO1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86WK6
Molecular weight:
41.58 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Gly28–Thr372
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AMIGO1, N-His

Product name ARO-P12917-100
Uniprot ID Q86WK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNT
Molecular weight 41.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly28-Thr372
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P12917
Note For research use only.
Molecular Constructor
Gly28–Thr372
Product name ARO-P12917-1MG
Uniprot ID Q86WK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNT
Molecular weight 41.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly28-Thr372
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P12917
Note For research use only.
Molecular Constructor
Gly28–Thr372
Product name ARO-P12917-50
Uniprot ID Q86WK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRAVVSCPAACLCASNILSCSKQQLPNVPHSLPSYTALLDLSHNNLSRLRAEWTPTRLTQLHSLLLSHNHLNFISSEAFSPVPNLRYLDLSSNQLRTLDEFLFSDLQVLEVLLLYNNHIMAVDRCAFDDMAQLQKLYLSQNQISRFPLELVKEGAKLPKLTLLDLSSNKLKNLPLPDLQKLPAWIKNGLYLHNNPLNCDCELYQLFSHWQYRQLSSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDGSLLFQQVQVEDGGVYTCYAMGETFNETLSVELKVHNFTLHGHHDTLNT
Molecular weight 41.58 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly28-Thr372
Aliases /Synonyms AMIGO, AMIGO1, Amphoterin-induced protein 1, AMIGO-1, KIAA1163, Alivin-2, ALI2
Reference ARO-P12917
Note For research use only.
Molecular Constructor
Gly28–Thr372

Introduction

Recombinant Human AMIGO1, also known as Alivin-1 or Amphoterin-induced gene and ORF1, is a protein that plays a crucial role in cell signaling and development. This protein is encoded by the AMIGO1 gene and is found in various tissues and organs in the human body. In this article, we will discuss the structure, activity, and application of Recombinant Human AMIGO1.

Structure of Recombinant Human AMIGO1

Recombinant Human AMIGO1 is a 60 kDa protein with a molecular formula of C33H44N6O8S2. It is composed of 538 amino acids and has a predicted isoelectric point of 6.32. The protein contains a single transmembrane domain, a cytoplasmic tail, and an extracellular domain.

The extracellular domain of Recombinant Human AMIGO1 contains three immunoglobulin-like domains, which are responsible for protein-protein interactions. These domains are essential for the function of AMIGO1 in cell adhesion and signaling. The cytoplasmic tail of AMIGO1 contains a PDZ-binding motif, which allows the protein to interact with other proteins and participate in various signaling pathways.

In addition to the full-length protein, Recombinant Human AMIGO1 can also be produced in a truncated form, lacking the transmembrane and cytoplasmic domains. This truncated form is often used in research and as a therapeutic protein.

Activity of Recombinant Human AMIGO1

Recombinant Human AMIGO1 is involved in various cellular processes, including cell adhesion, migration, and differentiation. It is also known to play a role in neuronal development and synaptic plasticity. AMIGO1 has been shown to interact with several other proteins, such as Neogenin, Plexin-B2, and Ephrin-B3, to regulate these processes.

One of the key functions of AMIGO1 is its role in cell adhesion. The extracellular domains of AMIGO1 can interact with other proteins, such as L1CAM and integrins, to mediate cell-cell and cell-matrix adhesion. This is crucial for the proper development and maintenance of tissues and organs.

In addition to its role in cell adhesion, Recombinant Human AMIGO1 is also involved in cell signaling. The protein has been shown to activate the PI3K-Akt signaling pathway, which is important for cell survival and proliferation. AMIGO1 has also been found to regulate the activity of the MAPK/ERK pathway, which is involved in cell differentiation and migration.

Application of Recombinant Human AMIGO1

Due to its diverse functions and interactions with other proteins, Recombinant Human AMIGO1 has a wide range of potential applications. One of the main applications of this protein is in the field of neuroscience. AMIGO1 has been shown to play a role in neuronal development and synaptic plasticity, making it a potential therapeutic target for neurological disorders.

Recombinant Human AMIGO1 has also been studied for its potential role in cancer. It has been found to be overexpressed in various types of cancer, including breast, lung, and colon cancer. Targeting AMIGO1 could potentially inhibit cancer cell proliferation and migration, making it a promising target for cancer therapy.

In addition, Recombinant Human AMIGO1 has also been investigated for its potential use in tissue engineering. Its role in cell adhesion and signaling makes it a promising candidate for promoting cell growth and tissue regeneration.

Conclusion

Recombinant Human AMIGO1 is a 60 kDa protein with a complex structure and diverse functions. It plays a crucial role in cell

Recombinant Human AMIGO1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AMIGO1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products