Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AKAP7 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O43687
Molecular weight:
22.11 kDa

Original price was: €243.00.Current price is: €193.00.

50ug 21% OFF + 193 loyalty points
Ile16–Lys104
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AKAP7 Protein, N-His-SUMO

Product name ARO-P10817-100
Uniprot ID O43687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile16-Lys104
Aliases /Synonyms Protein kinase A-anchoring protein 7 isoforms alpha/beta, AKAP-7 isoforms alpha and beta, AKAP 18, AKAP18, AKAP15, AKAP7, A-kinase anchor protein 7 isoforms alpha and beta, PRKA7 isoforms alpha/beta, A-kinase anchor protein 18 kDa
Reference ARO-P10817
Note For research use only.
Molecular Constructor
Ile16–Lys104
Product name ARO-P10817-1MG
Uniprot ID O43687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile16-Lys104
Aliases /Synonyms Protein kinase A-anchoring protein 7 isoforms alpha/beta, AKAP-7 isoforms alpha and beta, AKAP 18, AKAP18, AKAP15, AKAP7, A-kinase anchor protein 7 isoforms alpha and beta, PRKA7 isoforms alpha/beta, A-kinase anchor protein 18 kDa
Reference ARO-P10817
Note For research use only.
Molecular Constructor
Ile16–Lys104
Product name ARO-P10817-50
Uniprot ID O43687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile16-Lys104
Aliases /Synonyms Protein kinase A-anchoring protein 7 isoforms alpha/beta, AKAP-7 isoforms alpha and beta, AKAP 18, AKAP18, AKAP15, AKAP7, A-kinase anchor protein 7 isoforms alpha and beta, PRKA7 isoforms alpha/beta, A-kinase anchor protein 18 kDa
Reference ARO-P10817
Note For research use only.
Molecular Constructor
Ile16–Lys104

Recombinant Human AKAP7 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human AKAP7 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products