Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ADI1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BV57
Molecular weight:
23.66 kDa

Original price was: €355.00.Current price is: €275.00.

100ug 23% OFF + 275 loyalty points
Met1–Ala179
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ADI1 Protein, N-His

Product name ARO-P12108-100
Uniprot ID Q9BV57
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala179
Aliases /Synonyms Sip-L, Acireductone dioxygenase (Fe(2+)-requiring), ADI1, ARD, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase, MTCBP-1, Submergence-induced protein-like factor, Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1, Fe-ARD, MTCBP1
Reference ARO-P12108
Note For research use only.
Molecular Constructor
Met1–Ala179
Product name ARO-P12108-1MG
Uniprot ID Q9BV57
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala179
Aliases /Synonyms Sip-L, Acireductone dioxygenase (Fe(2+)-requiring), ADI1, ARD, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase, MTCBP-1, Submergence-induced protein-like factor, Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1, Fe-ARD, MTCBP1
Reference ARO-P12108
Note For research use only.
Molecular Constructor
Met1–Ala179
Product name ARO-P12108-50
Uniprot ID Q9BV57
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
Molecular weight 23.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala179
Aliases /Synonyms Sip-L, Acireductone dioxygenase (Fe(2+)-requiring), ADI1, ARD, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase, MTCBP-1, Submergence-induced protein-like factor, Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1, Fe-ARD, MTCBP1
Reference ARO-P12108
Note For research use only.
Molecular Constructor
Met1–Ala179

Introduction

Recombinant Human ADI1 protein is a highly versatile and important protein that plays a crucial role in various cellular processes. This protein is encoded by the ADI1 gene and is also known as Acireductone dioxygenase 1. It is a member of the metallo-β-lactamase superfamily and is found in both prokaryotic and eukaryotic organisms. In this article, we will discuss the structure, activity, and applications of Recombinant Human ADI1 protein.

Structure of Recombinant Human ADI1 Protein

The Recombinant Human ADI1 protein is a 23 kDa protein that consists of 202 amino acids. It has a conserved metallo-β-lactamase domain and a C-terminal domain that is involved in dimerization. The crystal structure of this protein has been determined, and it has been found that it exists as a homodimer in its active form. The active site of the protein contains a zinc ion, which is essential for its enzymatic activity.

Activity of Recombinant Human ADI1 Protein

Recombinant Human ADI1 protein is an enzyme that catalyzes the conversion of aci-reductone to formate and methylglyoxal. This reaction is a key step in the methionine salvage pathway, which is important for maintaining cellular methionine levels. This protein also plays a crucial role in the detoxification of methylglyoxal, a toxic byproduct of glycolysis. Moreover, Recombinant Human ADI1 protein has been shown to have antioxidant activity, which helps in protecting cells from oxidative stress.

Applications of Recombinant Human ADI1 Protein

Recombinant Human ADI1 protein has a wide range of applications in various fields. Some of the major applications are discussed below:

1. Recombinant Protein Production

Recombinant Human ADI1 protein is widely used in the production of recombinant proteins. It is often fused with a protein of interest and expressed in a suitable host system to produce large quantities of the desired protein. The high solubility and stability of this protein make it an ideal candidate for use in protein production.

2. Diagnostic Assays

Recombinant Human ADI1 protein is also used in diagnostic assays for the detection of various diseases. It can be used as an antigen in immunoassays to detect the presence of antibodies against this protein in patient samples. This can help in the diagnosis of diseases such as cancer, autoimmune disorders, and infections.

3. Therapeutic Applications

Recombinant Human ADI1 protein has potential therapeutic applications. It has been shown to have anti-tumor activity and can be used in the treatment of certain types of cancer. This protein has also been found to have neuroprotective properties and can be used in the treatment of neurodegenerative diseases.

4. Bioremediation

Recombinant Human ADI1 protein is also being explored for its potential use in bioremediation. It has been shown to have the ability to degrade toxic compounds such as methylglyoxal and formaldehyde, making it a potential candidate for use in environmental clean-up.

5. Agriculture

Recombinant Human ADI1 protein has been used in agriculture for the production of transgenic plants with improved stress tolerance. This protein has been shown to enhance the plant’s ability to withstand drought and other environmental stresses, making it a valuable tool for crop improvement.

Conclusion

Recombinant Human ADI1 protein is a highly versatile protein that has a wide range of applications in various fields. Its unique structure and enzymatic activity make it an important protein for various cellular processes. With ongoing research, the potential applications of this protein are expected to expand, making it an essential tool in biotechnology and medicine.

SDS-PAGE for Recombinant Human ADI1 Protein, N-His

SDS-PAGE for Recombinant Human ADI1 Protein, N-His

Recombinant Human ADI1 Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human ADI1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ADI1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products