Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ACTN1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P12814
Molecular weight:
25.90 kDa

Original price was: €249.00.Current price is: €193.00.

50ug 22% OFF + 193 loyalty points
Asp26–Arg232
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ACTN1 Protein, N-His

Product name ARO-P11146-100
Uniprot ID P12814
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTAR
Molecular weight 25.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp26-Arg232
Aliases /Synonyms Alpha-actinin cytoskeletal isoform, Non-muscle alpha-actinin-1, Alpha-actinin-1, ACTN1, F-actin cross-linking protein
Reference ARO-P11146
Note For research use only.
Molecular Constructor
Asp26–Arg232
Product name ARO-P11146-1MG
Uniprot ID P12814
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTAR
Molecular weight 25.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp26-Arg232
Aliases /Synonyms Alpha-actinin cytoskeletal isoform, Non-muscle alpha-actinin-1, Alpha-actinin-1, ACTN1, F-actin cross-linking protein
Reference ARO-P11146
Note For research use only.
Molecular Constructor
Asp26–Arg232
Product name ARO-P11146-50
Uniprot ID P12814
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTAR
Molecular weight 25.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp26-Arg232
Aliases /Synonyms Alpha-actinin cytoskeletal isoform, Non-muscle alpha-actinin-1, Alpha-actinin-1, ACTN1, F-actin cross-linking protein
Reference ARO-P11146
Note For research use only.
Molecular Constructor
Asp26–Arg232

Introduction to Recombinant Human ACTN1 Protein

Recombinant Human ACTN1 protein, also known as alpha-actinin-1, is a cytoskeletal protein that plays a crucial role in maintaining the structural integrity of cells. It is encoded by the ACTN1 gene and is primarily found in non-muscle cells, such as fibroblasts, endothelial cells, and epithelial cells. This protein has been extensively studied due to its involvement in various cellular processes, including cell adhesion, migration, and signaling. In this article, we will explore the structure, activity, and applications of recombinant Human ACTN1 protein.

Structure of Recombinant Human ACTN1 Protein

Recombinant Human ACTN1 protein is a member of the spectrin superfamily and is composed of 894 amino acids. It consists of three major domains: an N-terminal actin-binding domain (ABD), a central rod domain, and a C-terminal calmodulin-like domain (CaM-LD). The ABD contains two calponin homology (CH) domains, which are responsible for binding to actin filaments. The rod domain is composed of spectrin repeats, which are responsible for dimerization and binding to other proteins. The CaM-LD is responsible for binding to calcium ions and regulating the activity of the protein.

Activity of Recombinant Human ACTN1 Protein

Recombinant Human ACTN1 protein is involved in various cellular activities, including cell adhesion, migration, and signaling. It plays a crucial role in maintaining the structural integrity of cells by cross-linking actin filaments and connecting them to the plasma membrane. This allows cells to withstand mechanical stress and maintain their shape. In addition, ACTN1 is involved in cell migration by regulating the formation and turnover of focal adhesions, which are essential for cell movement. Furthermore, ACTN1 has been shown to play a role in cell signaling by interacting with various signaling molecules, such as integrins and growth factor receptors.

Applications of Recombinant Human ACTN1 Protein

Recombinant Human ACTN1 protein has various applications in both research and therapeutic settings. In research, it is commonly used as an antigen in studies related to cytoskeletal dynamics, cell adhesion, and migration. It is also used as a tool to study the role of ACTN1 in diseases, such as cancer and cardiovascular disorders. In addition, recombinant Human ACTN1 protein is used in protein-protein interaction studies to identify its binding partners and understand its role in different signaling pathways.

In therapeutic settings, recombinant Human ACTN1 protein has potential applications in tissue engineering and regenerative medicine. Its ability to cross-link actin filaments and connect them to the plasma membrane makes it a promising candidate for promoting cell adhesion and tissue formation. Furthermore, ACTN1 has been shown to play a role in wound healing, making it a potential target for developing therapies for chronic wounds.

Conclusion

Recombinant Human ACTN1 protein is a crucial cytoskeletal protein that is involved in various cellular processes. Its structure, consisting of an actin-binding domain, a rod domain, and a calmodulin-like domain, allows it to perform its functions of maintaining cell structure, regulating cell migration, and participating in cell signaling. This protein has diverse applications in research and therapeutics, making it a valuable tool for understanding cellular processes and developing potential treatments for various diseases. Overall, recombinant Human ACTN1 protein is an essential protein that continues to be extensively studied for its role in maintaining the structural integrity of cells.

Recombinant Human ACTN1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ACTN1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products