Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ACSL5, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9ULC5
Molecular weight:
30.39 kDa

Original price was: €303.00.Current price is: €275.00.

100ug 9% OFF + 275 loyalty points
Arg432–Asp683
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ACSL5, N-His

Product name ARO-P12940-100
Uniprot ID Q9ULC5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD
Molecular weight 30.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg432-Asp683
Aliases /Synonyms Long-chain acyl-CoA synthetase 5, Long-chain-fatty-acid--CoA ligase 5, ACSL5, FACL5, LACS 5, Arachidonate--CoA ligase, ACS5
Reference ARO-P12940
Note For research use only.
Molecular Constructor
Arg432–Asp683

Introduction to Recombinant Human ACSL5

Recombinant Human ACSL5, also known as Acyl-CoA Synthetase Long-Chain Family Member 5, is a protein that plays a crucial role in fatty acid metabolism. It is a member of the acyl-CoA synthetase family, which are enzymes responsible for activating fatty acids for use in various cellular processes. Recombinant Human ACSL5 is a genetically engineered version of the human ACSL5 protein, produced through recombinant DNA technology. This technology allows for the production of large quantities of pure and biologically active proteins for use in research and therapeutic applications.

Structure of Recombinant Human ACSL5

Recombinant Human ACSL5 is a 72 kDa protein consisting of 666 amino acids. It contains a highly conserved ATP-binding domain and a long-chain fatty acid-binding domain, both of which are essential for its enzymatic activity. The protein also has two transmembrane domains, which allow it to be anchored to the endoplasmic reticulum, where it carries out its function. Recombinant Human ACSL5 shares a high degree of sequence similarity with other members of the ACSL family, but it has distinct structural features that make it unique.

Activity of Recombinant Human ACSL5

The primary function of Recombinant Human ACSL5 is to activate long-chain fatty acids by converting them into acyl-CoA, which is the preferred form for cellular utilization. This process, known as fatty acid activation, is essential for various cellular processes such as energy production, lipid synthesis, and membrane formation. Recombinant Human ACSL5 is highly specific for long-chain fatty acids, with a preference for arachidonic acid, docosahexaenoic acid, and palmitic acid. Its activity is regulated by the availability of fatty acids and ATP, as well as post-translational modifications such as phosphorylation.

Applications of Recombinant Human ACSL5

Recombinant Human ACSL5 has numerous applications in both research and therapeutic settings. In research, it is commonly used as a tool to study fatty acid metabolism and its role in various diseases such as obesity, diabetes, and cancer. Recombinant Human ACSL5 is also used to screen for potential inhibitors or activators of the enzyme, which can aid in drug discovery and development.

In therapeutic settings, Recombinant Human ACSL5 has shown potential as a target for the treatment of various diseases. For example, studies have shown that inhibiting the activity of ACSL5 can reduce the growth and metastasis of cancer cells, making it a potential target for cancer therapy. Additionally, mutations in the ACSL5 gene have been linked to various metabolic disorders, and the use of Recombinant Human ACSL5 in gene therapy could potentially correct these mutations and treat the underlying condition.

Conclusion

In summary, Recombinant Human ACSL5 is a crucial enzyme involved in fatty acid metabolism, with a specific role in fatty acid activation. Its unique structure and activity make it an essential tool in research and a potential target for therapeutic interventions. As the understanding of fatty acid metabolism and its role in diseases continues to grow, the importance of Recombinant Human ACSL5 and its applications will only increase.

Recombinant Human ACSL5, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ACSL5, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products