Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ACD Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96AP0
Molecular weight:
23.01 kDa

Original price was: €228.00.Current price is: €193.00.

50ug 15% OFF + 193 loyalty points
Ser24–Ser124
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ACD Protein, N-His-SUMO

Product name ARO-P10714-100
Uniprot ID Q96AP0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFS
Molecular weight 23.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser24-Ser124
Aliases /Synonyms ACD, Adrenocortical dysplasia protein homolog, PTOP, POT1 and TIN2-interacting protein, PIP1, TINT1, TPP1
Reference ARO-P10714
Note For research use only.
Molecular Constructor
Ser24–Ser124
Product name ARO-P10714-1MG
Uniprot ID Q96AP0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFS
Molecular weight 23.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser24-Ser124
Aliases /Synonyms ACD, Adrenocortical dysplasia protein homolog, PTOP, POT1 and TIN2-interacting protein, PIP1, TINT1, TPP1
Reference ARO-P10714
Note For research use only.
Molecular Constructor
Ser24–Ser124
Product name ARO-P10714-50
Uniprot ID Q96AP0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFS
Molecular weight 23.01 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser24-Ser124
Aliases /Synonyms ACD, Adrenocortical dysplasia protein homolog, PTOP, POT1 and TIN2-interacting protein, PIP1, TINT1, TPP1
Reference ARO-P10714
Note For research use only.
Molecular Constructor
Ser24–Ser124

Introduction

Recombinant Human ACD Protein, also known as Antigen CD, is a widely used recombinant protein in the field of immunology. This protein is produced through recombinant DNA technology, allowing for precise control over its structure and function. In this article, we will delve into the structure, activity, and applications of Recombinant Human ACD Protein.

Structure of Recombinant Human ACD Protein

Recombinant Human ACD Protein is a glycoprotein composed of 214 amino acids. It has a molecular weight of approximately 24 kDa and is composed of three domains: an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain contains the antigenic sites, which are responsible for the protein’s immunogenicity. The transmembrane domain anchors the protein to the cell membrane, while the intracellular domain is involved in signal transduction.

Activity of Recombinant Human ACD Protein

The primary function of Recombinant Human ACD Protein is to act as an antigen. It is expressed on the surface of antigen-presenting cells, such as dendritic cells, macrophages, and B cells. These cells play a crucial role in the adaptive immune response by presenting antigens to T cells. Recombinant Human ACD Protein binds to the T cell receptor and initiates a signaling cascade, leading to the activation and proliferation of T cells. This process is essential for the development of an effective immune response against pathogens and foreign substances.

In addition to its role as an antigen, Recombinant Human ACD Protein also has other activities. It has been shown to have anti-inflammatory properties by inhibiting the production of pro-inflammatory cytokines and promoting the production of anti-inflammatory cytokines. This makes it a potential therapeutic target for inflammatory diseases.

Applications of Recombinant Human ACD Protein

Recombinant Human ACD Protein has a wide range of applications in both research and clinical settings. Its ability to activate T cells makes it a valuable tool in studying the immune system and its response to different antigens. It is also used in vaccine development, as it can be used to induce an immune response against specific antigens.

In the clinical setting, Recombinant Human ACD Protein has shown promise as a potential treatment for certain types of cancer. Its ability to activate T cells can be harnessed to target and kill cancer cells. It has also been studied for its potential use in autoimmune diseases, as it can regulate the immune response and prevent excessive inflammation.

Furthermore, Recombinant Human ACD Protein has been used in diagnostic tests to detect the presence of specific antibodies in patient samples. This is particularly useful in the diagnosis of infectious diseases, as well as in monitoring the immune response to vaccines.

Conclusion

In summary, Recombinant Human ACD Protein is a versatile and valuable protein in the field of immunology. Its precise structure and ability to activate T cells make it a crucial component in the immune response against pathogens and foreign substances. Its potential applications in research and clinical settings make it a promising target for further study and development.

Keywords: Recombinant Human ACD Protein, antigen, recombinant protein, immunology, immune response, T cells, vaccine, cancer, autoimmune diseases, diagnostic tests.

Recombinant Human ACD Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human ACD Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products