Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ABCF2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UG63
Molecular weight:
28.51 kDa

Original price was: €224.00.Current price is: €193.00.

50ug 14% OFF + 193 loyalty points
Ile396–Val623
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ABCF2, N-His

Product name ARO-P12939-100
Uniprot ID Q9UG63
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV
Molecular weight 28.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile396-Val623
Aliases /Synonyms ATP-binding cassette sub-family F member 2, Iron-inhibited ABC transporter 2, ABCF2
Reference ARO-P12939
Note For research use only.
Molecular Constructor
Ile396–Val623
Product name ARO-P12939-1MG
Uniprot ID Q9UG63
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV
Molecular weight 28.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile396-Val623
Aliases /Synonyms ATP-binding cassette sub-family F member 2, Iron-inhibited ABC transporter 2, ABCF2
Reference ARO-P12939
Note For research use only.
Molecular Constructor
Ile396–Val623
Product name ARO-P12939-50
Uniprot ID Q9UG63
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence IMVQNVSFKYTKDGPCIYNNLEFGIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVSPIRNLSDGQKCRVCLAWLAWQNPHMLFLDEPTNHLDIETIDALADAINEFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDILAYKEHLKSKLVDEEPQLTKRTHNV
Molecular weight 28.51 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile396-Val623
Aliases /Synonyms ATP-binding cassette sub-family F member 2, Iron-inhibited ABC transporter 2, ABCF2
Reference ARO-P12939
Note For research use only.
Molecular Constructor
Ile396–Val623

Introduction to Recombinant Human ABCF2

Recombinant Human ABCF2 is a protein that is artificially produced in a laboratory using genetic engineering techniques. It belongs to the ATP-binding cassette (ABC) superfamily of transporters and is also known as ATP-binding cassette sub-family F member 2.

Structure of Recombinant Human ABCF2

The structure of Recombinant Human ABCF2 is composed of two transmembrane domains and two nucleotide-binding domains. The transmembrane domains are responsible for the transport of molecules across the cell membrane, while the nucleotide-binding domains are involved in the binding and hydrolysis of ATP, which provides the energy for transport.

The transmembrane domains of Recombinant Human ABCF2 are made up of six alpha-helices, which form a barrel-like structure. These helices are hydrophobic in nature and help to anchor the protein in the cell membrane. The nucleotide-binding domains, on the other hand, are composed of two subdomains, each containing a Walker A and Walker B motif. These motifs are involved in the binding and hydrolysis of ATP.

Activity of Recombinant Human ABCF2

Recombinant Human ABCF2 is a transporter protein that plays a crucial role in the transport of molecules across the cell membrane. It is primarily involved in the transport of lipids, such as cholesterol and phospholipids, as well as drugs and other toxins out of the cell.

The activity of Recombinant Human ABCF2 is dependent on the binding and hydrolysis of ATP. When ATP binds to the nucleotide-binding domains, a conformational change occurs in the protein, allowing it to bind to the molecule to be transported. This is followed by the hydrolysis of ATP, which provides the energy for the transport of the molecule across the cell membrane.

Recombinant Human ABCF2 is also involved in the transport of molecules within the cell, such as from the endoplasmic reticulum to the Golgi apparatus. This is important for the proper functioning of the cell and maintaining homeostasis.

Application of Recombinant Human ABCF2

Recombinant Human ABCF2 has a wide range of applications in both research and medicine. Its role in the transport of lipids and drugs makes it a potential target for the development of new therapies for diseases such as cancer, where abnormal lipid metabolism is often observed.

In research, Recombinant Human ABCF2 is used to study the mechanisms of transport across the cell membrane. It is also used to investigate the role of ABC transporters in drug resistance, as overexpression of ABC transporters is often associated with drug resistance in cancer cells.

Recombinant Human ABCF2 is also used in the production of vaccines. It can be used as an antigen to stimulate the immune system and generate an immune response, which can then be used to protect against certain diseases.

Conclusion

In summary, Recombinant Human ABCF2 is a transporter protein that plays a crucial role in the transport of molecules across the cell membrane. Its structure, activity, and applications make it a valuable tool in both research and medicine. Further studies on this protein may lead to the development of new therapies for various diseases and improve our understanding of the mechanisms of transport in the cell.

Recombinant Human ABCF2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ABCF2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products