Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Flag tag Control Protein

Host species:
Escherichia coli (E.coli)
Origin species:
General
Uniprot ID:
P03772
Molecular weight:
27.32 kDa

Original price was: €278.00.Current price is: €230.00.

50ug 17% OFF + 230 loyalty points
Met1–Ala221
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Flag tag Control Protein

Product name ARO-P12696-100
Uniprot ID P03772
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
Molecular weight 27.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala221
Aliases /Synonyms Flag tag Control Protein, Flag tag Protein
Reference ARO-P12696
Note For research use only.
Molecular Constructor
Met1–Ala221
Product name ARO-P12696-1MG
Uniprot ID P03772
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
Molecular weight 27.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala221
Aliases /Synonyms Flag tag Control Protein, Flag tag Protein
Reference ARO-P12696
Note For research use only.
Molecular Constructor
Met1–Ala221
Product name ARO-P12696-50
Uniprot ID P03772
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
Molecular weight 27.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala221
Aliases /Synonyms Flag tag Control Protein, Flag tag Protein
Reference ARO-P12696
Note For research use only.
Molecular Constructor
Met1–Ala221

The Structure and Function of Recombinant Flag tag Control Protein

Recombinant Flag tag Control Protein, also known as Flag-tagged protein or simply Flag protein, is a widely used tool in the field of biotechnology and molecular biology. It is a fusion protein consisting of a short amino acid sequence, known as the Flag tag, and a protein of interest. The Flag tag is a hydrophilic peptide sequence derived from the gene encoding the protein flagellin, which is found in bacteria. This tag is typically added to the N- or C-terminus of the protein of interest and allows for easy detection, purification, and manipulation of the tagged protein.

Structure of Recombinant Flag tag Control Protein

The Flag tag itself is a small peptide sequence of eight amino acids: Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys. This sequence is designed to be highly antigenic, meaning it can easily be recognized by antibodies. The Flag tag is also hydrophilic, which makes it soluble in aqueous solutions and helps to minimize any potential interference with the structure and function of the tagged protein. The Flag tag is often used in combination with other tags, such as His-tag or GFP, to provide additional functionality and versatility.
The fusion of the Flag tag with the protein of interest does not significantly alter the structure or function of the tagged protein. This is because the Flag tag is small and does not interfere with the folding or activity of the protein. Additionally, the Flag tag is usually placed at the termini of the protein, which are typically less critical for its function. Therefore, the addition of the Flag tag does not affect the biological activity of the tagged protein, making it a useful tool for studying protein function.

Activity of Recombinant Flag tag Control Protein

The primary function of Recombinant Flag tag Control Protein is to act as a molecular handle for the tagged protein, allowing for its easy detection, purification, and manipulation. The presence of the Flag tag on the tagged protein can be detected using specific antibodies, which bind to the tag with high affinity and specificity. This allows for the quick and sensitive detection of the tagged protein in various experimental settings, such as Western blotting, immunoprecipitation, and immunofluorescence.
The Flag tag also facilitates the purification of the tagged protein from complex biological samples. Recombinant Flag tag Control Protein can be purified using affinity chromatography, where the Flag tag is specifically bound to a solid support, such as resin or magnetic beads. This allows for the isolation of the tagged protein from a mixture of other proteins, providing a highly purified sample for further analysis.
In addition to its use as a detection and purification tool, Recombinant Flag tag Control Protein can also be used for protein engineering and manipulation. The Flag tag can be easily removed or replaced using specific proteases, such as enterokinase or thrombin, without affecting the structure or function of the tagged protein. This allows for the generation of different versions of the tagged protein, such as truncated or mutated forms, for studying their role in various biological processes.

Application of Recombinant Flag tag Control Protein

The versatility and ease of use of Recombinant Flag tag Control Protein make it a valuable tool in various research areas. It is commonly used in protein expression and purification studies, where the tagged protein can be easily detected and purified for downstream applications. It is also widely used in protein-protein interaction studies, where the Flag tag can be added to both interacting proteins for their co-purification and analysis.
Moreover, Recombinant Flag tag Control Protein has also found applications in drug discovery and development. The Flag tag can be used as a therapeutic target for the development of new drugs, as it allows for the specific targeting and delivery of drugs to the tagged protein. This is particularly useful for targeting proteins that are difficult to isolate or purify using traditional methods.

SDS-PAGE for Recombinant Flag tag Control Protein

SDS-PAGE for Recombinant Flag tag Control Protein

Recombinant Flag tag Control Protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Flag tag Control Protein

There are no reviews yet.

Be the first to review “Recombinant Flag tag Control Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products