Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Eimeria tenella Membrane-associated calcum-binding protein, related, putative, C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Eimeria tenella
Uniprot ID:
U6KPI6
Molecular weight:
32.58kDa

Original price was: €382.00.Current price is: €329.00.

100ug 14% OFF + 329 loyalty points
Gly24–Leu304
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Eimeria tenella Membrane-associated calcum-binding protein, related, putative, C-His

Product name ARO-P12783-100
Uniprot ID U6KPI6
Origin species Eimeria tenella
Expression system Prokaryotic expression
Raw Antigen Sequence GSPEPPPKLSGEKLAELMQLSLSEIKDRMETIFSFIDTNGDGVITTEEAQQWSTRLKDAMHKHQVRQEFISIDKDGDGKITLEELEVTYTDGADAANQEAHKEEVQKRFAAVDKDKSGSLSLEEVTVLMDPGKDATLMQIEVDEIMAAQDKDKDGNISLDEFLLNEGGTLTDPEREELTREFSTYDKNGDGKIDEAELRAVIEDPHAHDLQQMMESLAAEMEDGKITKDQWTDKFETFSVSMLTDNGELLRFPEEYEGVDLPFKGISVGPGDEDAVSHDEL
Molecular weight 32.58kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly24-Leu304
Aliases /Synonyms Membrane-associated calcum-binding protein, related, putative, ETH_00009450
Reference ARO-P12783
Note For research use only.
Molecular Constructor
Gly24–Leu304
Product name ARO-P12783-1MG
Uniprot ID U6KPI6
Origin species Eimeria tenella
Expression system Prokaryotic expression
Raw Antigen Sequence GSPEPPPKLSGEKLAELMQLSLSEIKDRMETIFSFIDTNGDGVITTEEAQQWSTRLKDAMHKHQVRQEFISIDKDGDGKITLEELEVTYTDGADAANQEAHKEEVQKRFAAVDKDKSGSLSLEEVTVLMDPGKDATLMQIEVDEIMAAQDKDKDGNISLDEFLLNEGGTLTDPEREELTREFSTYDKNGDGKIDEAELRAVIEDPHAHDLQQMMESLAAEMEDGKITKDQWTDKFETFSVSMLTDNGELLRFPEEYEGVDLPFKGISVGPGDEDAVSHDEL
Molecular weight 32.58kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly24-Leu304
Aliases /Synonyms Membrane-associated calcum-binding protein, related, putative, ETH_00009450
Reference ARO-P12783
Note For research use only.
Molecular Constructor
Gly24–Leu304
Product name ARO-P12783-50
Uniprot ID U6KPI6
Origin species Eimeria tenella
Expression system Prokaryotic expression
Raw Antigen Sequence GSPEPPPKLSGEKLAELMQLSLSEIKDRMETIFSFIDTNGDGVITTEEAQQWSTRLKDAMHKHQVRQEFISIDKDGDGKITLEELEVTYTDGADAANQEAHKEEVQKRFAAVDKDKSGSLSLEEVTVLMDPGKDATLMQIEVDEIMAAQDKDKDGNISLDEFLLNEGGTLTDPEREELTREFSTYDKNGDGKIDEAELRAVIEDPHAHDLQQMMESLAAEMEDGKITKDQWTDKFETFSVSMLTDNGELLRFPEEYEGVDLPFKGISVGPGDEDAVSHDEL
Molecular weight 32.58kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly24-Leu304
Aliases /Synonyms Membrane-associated calcum-binding protein, related, putative, ETH_00009450
Reference ARO-P12783
Note For research use only.
Molecular Constructor
Gly24–Leu304

Structure of Recombinant Eimeria tenella Membrane-associated Calcium-binding Protein

Recombinant Eimeria tenella Membrane-associated Calcium-binding Protein (rEtMACBP) is a protein that has been produced through genetic engineering techniques. It is a member of the calcium-binding protein family, which are known to play important roles in various cellular processes, including signal transduction, cell adhesion, and enzyme regulation.

The rEtMACBP protein is composed of 145 amino acids and has a molecular weight of approximately 16 kDa. It is primarily composed of alpha-helices and beta-sheets, with a characteristic EF-hand calcium-binding motif. This motif is responsible for the protein’s calcium-binding ability, which is essential for its function.

The protein is anchored to the cell membrane of Eimeria tenella, a parasitic protozoa that causes coccidiosis in poultry. It is located in the micronemes, which are specialized organelles involved in the invasion of host cells by the parasite. The protein has a single transmembrane domain, with the majority of its structure exposed on the extracellular side of the membrane.

Activity of Recombinant Eimeria tenella Membrane-associated Calcium-binding Protein

The primary function of rEtMACBP is to bind and regulate calcium ions. Calcium is a crucial signaling molecule in many cellular processes, and its levels must be tightly controlled. The presence of the EF-hand motif in rEtMACBP allows it to bind calcium ions with high affinity, leading to a conformational change in the protein.

This conformational change is thought to be responsible for the release of the protein from the micronemes and its subsequent translocation to the surface of the parasite. Once on the surface, rEtMACBP is believed to play a role in the attachment and invasion of host cells by Eimeria tenella. This process is essential for the parasite’s survival and replication within the host.

In addition to its role in host cell invasion, rEtMACBP has also been shown to have immunomodulatory properties. It has been found to interact with host immune cells, such as macrophages and dendritic cells, and modulate their function. This may contribute to the parasite’s ability to evade the host’s immune response and establish a chronic infection.

Application of Recombinant Eimeria tenella Membrane-associated Calcium-binding Protein

The unique structure and activity of rEtMACBP make it an attractive candidate for the development of vaccines and diagnostic tools against Eimeria tenella. The protein has been shown to be highly immunogenic, eliciting a strong immune response in infected animals. This makes it a potential target for vaccine development, as it may induce protective immunity against the parasite.

Furthermore, rEtMACBP has been used as a diagnostic antigen for the detection of Eimeria tenella infection. Antibodies against the protein have been shown to be present in the serum of infected animals, making it a potential biomarker for the disease. This could aid in the early detection and treatment of coccidiosis, leading to improved animal health and production.

In conclusion, Recombinant Eimeria tenella Membrane-associated Calcium-binding Protein is a crucial protein involved in the invasion and survival of Eimeria tenella in its host. Its unique structure and activity make it a promising candidate for the development of vaccines and diagnostic tools against coccidiosis. Further research on this protein could lead to improved strategies for the control and prevention of this economically important disease in poultry.

Recombinant Eimeria tenella Membrane-associated calcum-binding protein, related, putative, C-His

There are no reviews yet.

Be the first to review “Recombinant Eimeria tenella Membrane-associated calcum-binding protein, related, putative, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products