Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant DENV-3 Envelope protein E, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Dengue virus type 3 (strain Philippines/H87/1956) (DENV-3)
Uniprot ID:
P27915
Molecular weight:
13.55 kDa

Original price was: €421.00.Current price is: €329.00.

100ug 22% OFF + 329 loyalty points
Met575–Lys678
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant DENV-3 Envelope protein E, N-His

Product name ARO-P12714-100
Uniprot ID P27915
Origin species Dengue virus type 3 (strain Philippines/H87/1956) (DENV-3)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYAMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDKALKINWYRKGSSIGK
Molecular weight 13.55 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met575-Lys678
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12714
Note For research use only.
Molecular Constructor
Met575–Lys678
Product name ARO-P12714-1MG
Uniprot ID P27915
Origin species Dengue virus type 3 (strain Philippines/H87/1956) (DENV-3)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYAMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDKALKINWYRKGSSIGK
Molecular weight 13.55 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met575-Lys678
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12714
Note For research use only.
Molecular Constructor
Met575–Lys678
Product name ARO-P12714-50
Uniprot ID P27915
Origin species Dengue virus type 3 (strain Philippines/H87/1956) (DENV-3)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYAMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDKALKINWYRKGSSIGK
Molecular weight 13.55 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met575-Lys678
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12714
Note For research use only.
Molecular Constructor
Met575–Lys678

Introduction

The recombinant DENV-3 Envelope protein E (rE-DENV-3) is a synthetic version of the envelope protein found on the surface of the dengue virus serotype 3 (DENV-3). This protein is produced using recombinant DNA technology, which involves inserting the gene that codes for the envelope protein into a host cell, such as bacteria or yeast, to produce large quantities of the protein. The rE-DENV-3 has been extensively studied and has shown promising potential as a diagnostic tool and vaccine candidate for dengue virus infection.

Structure of Recombinant DENV-3 Envelope protein E

The rE-DENV-3 is a glycoprotein with a molecular weight of approximately 50 kDa. It is composed of three structural domains: domain I, domain II, and domain III. Domain I is the central domain and contains the fusion loop, which is responsible for the attachment of the virus to host cells. Domain II is involved in the dimerization of the envelope protein, while domain III is responsible for receptor binding. The rE-DENV-3 also contains two glycosylation sites, which are important for its stability and function.

Activity of Recombinant DENV-3 Envelope protein E

The main function of the rE-DENV-3 is to elicit an immune response in the host. This is achieved through its ability to act as an antigen, which is a substance that triggers the production of antibodies by the immune system. The rE-DENV-3 has been shown to induce the production of neutralizing antibodies, which can bind to and block the activity of the virus, preventing infection. This activity has been demonstrated in both in vitro and in vivo studies.

In addition to its role as an antigen, the rE-DENV-3 also has the ability to bind to host cells and mediate viral entry. This is due to its fusion loop, which interacts with receptors on the surface of host cells, allowing the virus to enter and infect the cell. This activity is crucial for the virus to replicate and cause disease.

Application of Recombinant DENV-3 Envelope protein E

The rE-DENV-3 has several potential applications in the field of dengue virus research and control. One of the main applications is as a diagnostic tool for dengue virus infection. The rE-DENV-3 can be used in various diagnostic tests, such as enzyme-linked immunosorbent assays (ELISAs) and lateral flow assays, to detect the presence of dengue virus-specific antibodies in patient samples. This can aid in the early and accurate diagnosis of dengue virus infection, allowing for prompt treatment and control of the disease.

Another important application of the rE-DENV-3 is in the development of a dengue virus vaccine. The rE-DENV-3 has been shown to induce a strong and specific immune response, making it a potential candidate for inclusion in a dengue virus vaccine. Several studies have demonstrated the efficacy of the rE-DENV-3 as a vaccine antigen, with promising results in both animal and human trials. Its ability to elicit neutralizing antibodies and prevent viral entry makes it a valuable component in the fight against dengue virus infection.

Conclusion

The recombinant DENV-3 Envelope protein E is a synthetic version of the envelope protein found on the surface of the dengue virus serotype 3. Its structure, activity, and potential applications make it a valuable tool in dengue virus research and control. Its use as a diagnostic tool and vaccine candidate highlights its potential in the fight against dengue virus infection. Further research and development of the rE-DENV-3 may lead to new and improved ways to prevent and control this devastating disease.

Recombinant DENV-3 Envelope protein E, N-His

There are no reviews yet.

Be the first to review “Recombinant DENV-3 Envelope protein E, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products