Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Coxiella burnetii rplL Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Uniprot ID:
P0C8S3
Molecular weight:
35.32 kDa

Original price was: €288.00.Current price is: €230.00.

50ug 20% OFF + 230 loyalty points
Asn61–Glu126
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Coxiella burnetii rplL Protein, N-GST & C-His

Product name ARO-P10918-100
Uniprot ID P0C8S3
Origin species Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Expression system Prokaryotic expression
Raw Antigen Sequence NVKMVSFGDNKIGVIKAIRTITGLGLKEAKDLVESVPSVVKESVSKEEAEKIKKELEEAGAKVELE
Molecular weight 35.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn61-Glu126
Aliases /Synonyms Large ribosomal subunit protein bL12, 50S ribosomal protein L7/L12, rplL, CBU_0229
Reference ARO-P10918
Note For research use only.
Molecular Constructor
Asn61–Glu126
Product name ARO-P10918-1MG
Uniprot ID P0C8S3
Origin species Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Expression system Prokaryotic expression
Raw Antigen Sequence NVKMVSFGDNKIGVIKAIRTITGLGLKEAKDLVESVPSVVKESVSKEEAEKIKKELEEAGAKVELE
Molecular weight 35.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn61-Glu126
Aliases /Synonyms Large ribosomal subunit protein bL12, 50S ribosomal protein L7/L12, rplL, CBU_0229
Reference ARO-P10918
Note For research use only.
Molecular Constructor
Asn61–Glu126
Product name ARO-P10918-50
Uniprot ID P0C8S3
Origin species Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Expression system Prokaryotic expression
Raw Antigen Sequence NVKMVSFGDNKIGVIKAIRTITGLGLKEAKDLVESVPSVVKESVSKEEAEKIKKELEEAGAKVELE
Molecular weight 35.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn61-Glu126
Aliases /Synonyms Large ribosomal subunit protein bL12, 50S ribosomal protein L7/L12, rplL, CBU_0229
Reference ARO-P10918
Note For research use only.
Molecular Constructor
Asn61–Glu126

Recombinant Coxiella burnetii rplL Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Coxiella burnetii rplL Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products