Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Clostridium tetani (strain Massachusetts / E88)
Uniprot ID:
P04958
Molecular weight:
54.66 kDa

Original price was: €299.00.Current price is: €230.00.

50ug 23% OFF + 230 loyalty points
Met1–Ser458
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein, N-His

Product name ARO-P10832-100
Uniprot ID P04958
Origin species Clostridium tetani (strain Massachusetts / E88)
Expression system Prokaryotic expression
Raw Antigen Sequence MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTAS
Molecular weight 54.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser458
Aliases /Synonyms Tetanus toxin, 3.4.24.68, Tentoxylysin, Tetanus toxin light chain, Tetanus toxin chain L, Tetanus toxin heavy chain, Tetanus toxin chain H, tetX, CTC_p60, Clostridium tetani (strain Massachusetts / E88)
Reference ARO-P10832
Note For research use only.
Molecular Constructor
Met1–Ser458
Product name ARO-P10832-1MG
Uniprot ID P04958
Origin species Clostridium tetani (strain Massachusetts / E88)
Expression system Prokaryotic expression
Raw Antigen Sequence MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTAS
Molecular weight 54.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser458
Aliases /Synonyms Tetanus toxin, 3.4.24.68, Tentoxylysin, Tetanus toxin light chain, Tetanus toxin chain L, Tetanus toxin heavy chain, Tetanus toxin chain H, tetX, CTC_p60, Clostridium tetani (strain Massachusetts / E88)
Reference ARO-P10832
Note For research use only.
Molecular Constructor
Met1–Ser458
Product name ARO-P10832-50
Uniprot ID P04958
Origin species Clostridium tetani (strain Massachusetts / E88)
Expression system Prokaryotic expression
Raw Antigen Sequence MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTAS
Molecular weight 54.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser458
Aliases /Synonyms Tetanus toxin, 3.4.24.68, Tentoxylysin, Tetanus toxin light chain, Tetanus toxin chain L, Tetanus toxin heavy chain, Tetanus toxin chain H, tetX, CTC_p60, Clostridium tetani (strain Massachusetts / E88)
Reference ARO-P10832
Note For research use only.
Molecular Constructor
Met1–Ser458

Introduction to Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein

Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein is a highly potent and immunogenic protein that is produced by the bacterium Clostridium tetani. This protein is a major virulence factor of the bacterium and is responsible for the development of tetanus, a potentially fatal disease characterized by muscular stiffness and spasms. The recombinant form of this protein has been extensively studied and has shown great potential as a vaccine candidate and in various other applications.

Structure of Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein

The recombinant form of Clostridium tetani tetX/Tetanus toxin/TeNT Protein is a 150 kDa protein consisting of a single chain of 1315 amino acids. It is composed of three distinct domains: the N-terminal translocation domain, the central receptor-binding domain, and the C-terminal catalytic domain. The translocation domain is responsible for the entry of the protein into the host cell, while the receptor-binding domain is responsible for binding to specific receptors on the surface of nerve cells. The catalytic domain is responsible for the enzymatic activity of the protein, which is crucial for its pathogenicity.

Activity of Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein

The primary activity of Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein is to cause tetanus by inhibiting the release of neurotransmitters from nerve cells. This is achieved through the cleavage of specific proteins involved in the release of neurotransmitters, leading to the disruption of nerve impulses and the characteristic symptoms of tetanus. The protein also has immunomodulatory properties, which contribute to its ability to evade the host immune response and cause persistent infection.

Application of Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein

The recombinant form of Clostridium tetani tetX/Tetanus toxin/TeNT Protein has been extensively studied and has shown great potential for various applications, including:

Vaccine development

One of the most promising applications of Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein is in the development of a tetanus vaccine. The protein has been shown to be highly immunogenic and can elicit a strong and long-lasting immune response in animal models. This makes it a potential candidate for inclusion in a multivalent vaccine against tetanus and other related diseases.

Diagnostic tool

The recombinant protein can also be used as a diagnostic tool for the detection of tetanus infection. Antibodies against the protein can be used in various immunoassays to detect the presence of the protein in clinical samples, providing a rapid and accurate diagnosis of tetanus.

Research tool

Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein is also a valuable tool for research purposes. Its high potency and immunogenicity make it an ideal model for studying the mechanisms of pathogenicity and immune response in tetanus. It can also be used in the development of new therapies and treatments for tetanus and other related diseases.

Therapeutic agent

The recombinant protein has also shown potential as a therapeutic agent for the treatment of tetanus. It has been used in experimental studies to neutralize the effects of the toxin in animal models, providing a potential treatment option for severe cases of tetanus in humans.

Industrial applications

The protein has also been explored for its potential industrial applications, such as in the production of biodegradable plastics and biofuels. Its ability to bind to specific receptors on nerve cells also makes it a potential candidate for targeted drug delivery systems.

Conclusion

Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products