Brand: ProteoGenix

Recombinant ASFV S273R Protein, N-His

ARO-P10285-100
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Uniprot ID:: Q00946
Molecular weight:: 33.71 kDa

Original price was: €421.00.Current price is: €329.00.

100ug 22% OFF + 329 loyalty points

Met1–Ala273

Size Size

50ug Original price was: €281.00.Current price is: €230.00.
100ug Original price was: €421.00.Current price is: €329.00.
1MG Original price was: €1,126.00.Current price is: €954.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Recombinant ASFV S273R Protein, N-His

Product name	ARO-P10285-100
Uniprot ID	Q00946
Origin species	African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSILEKITSSPSECAEHLTNKDSCLSKKIQKELTSFLEKKETLGCDSESCVITHPAVKAYAQQKGLDLSKELETRFKAPGPRNNTGLLTNFNIDETLQRWAIKYTKFFNCPFSMMDFERVHYKFNQVDMVKVYKGEELQYVEGKVVKRPCNTFGCVLNTDFSTGTGKHWVAIFVDMRGDCWSIEYFNSAGNSPPGPVIRWMERVKQQLLKIHHTVKTLAVTNIRHQRSQTECGPYSLFYIRARLDNVSYAHFISARITDEDMYKFRTHLFRIA
Molecular weight	33.71 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Ala273
Aliases /Synonyms	Cysteine protease S273R, pS273R, 3.4.22.-, Ba71V-111, S273R
Reference	ARO-P10285
Note	For research use only.
Molecular Constructor	Met1–Ala273

Product name	ARO-P10285-1MG
Uniprot ID	Q00946
Origin species	African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSILEKITSSPSECAEHLTNKDSCLSKKIQKELTSFLEKKETLGCDSESCVITHPAVKAYAQQKGLDLSKELETRFKAPGPRNNTGLLTNFNIDETLQRWAIKYTKFFNCPFSMMDFERVHYKFNQVDMVKVYKGEELQYVEGKVVKRPCNTFGCVLNTDFSTGTGKHWVAIFVDMRGDCWSIEYFNSAGNSPPGPVIRWMERVKQQLLKIHHTVKTLAVTNIRHQRSQTECGPYSLFYIRARLDNVSYAHFISARITDEDMYKFRTHLFRIA
Molecular weight	33.71 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Ala273
Aliases /Synonyms	Cysteine protease S273R, pS273R, 3.4.22.-, Ba71V-111, S273R
Reference	ARO-P10285
Note	For research use only.
Molecular Constructor	Met1–Ala273

Product name	ARO-P10285-50
Uniprot ID	Q00946
Origin species	African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MSILEKITSSPSECAEHLTNKDSCLSKKIQKELTSFLEKKETLGCDSESCVITHPAVKAYAQQKGLDLSKELETRFKAPGPRNNTGLLTNFNIDETLQRWAIKYTKFFNCPFSMMDFERVHYKFNQVDMVKVYKGEELQYVEGKVVKRPCNTFGCVLNTDFSTGTGKHWVAIFVDMRGDCWSIEYFNSAGNSPPGPVIRWMERVKQQLLKIHHTVKTLAVTNIRHQRSQTECGPYSLFYIRARLDNVSYAHFISARITDEDMYKFRTHLFRIA
Molecular weight	33.71 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Ala273
Aliases /Synonyms	Cysteine protease S273R, pS273R, 3.4.22.-, Ba71V-111, S273R
Reference	ARO-P10285
Note	For research use only.
Molecular Constructor	Met1–Ala273