Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody

  • ARO-A13443-50
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: €164.00.Current price is: €118.00.

50ug 28% OFF + 118 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody binds to Recombinant BVDV E2 glycoprotein Protein, N-His in WB Assay
Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody

Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody

Product name ARO-A13443-100
Uniprot ID AGC12054.1
Raw Antigen Sequence CDAKPVVKGKFNTTLLNGPAFQMVCPMGWTGSVDCVLANKDTLKVVVVRTYKRARPFPNRQGCVTQKLLGEDLYDCTHGGNWTCIAGEQLHYTGGDIESCKWCGHKFLKSEGLPHYPIGKCRLKNETGYRLVDDTSCNRDGVAIVQHGTMKCRIGDTVVQVIAMDNKLGPMPCKPYEITPSEGPVEKTACTFNYTKTLRNKYFEPRDNYFQQYMLKGD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Reference ARO-A13443
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant BVDV (Mucosal disease virus) E2 glycoprotein (Cys1-Asp218).
Product name ARO-A13443-1MG
Uniprot ID AGC12054.1
Raw Antigen Sequence CDAKPVVKGKFNTTLLNGPAFQMVCPMGWTGSVDCVLANKDTLKVVVVRTYKRARPFPNRQGCVTQKLLGEDLYDCTHGGNWTCIAGEQLHYTGGDIESCKWCGHKFLKSEGLPHYPIGKCRLKNETGYRLVDDTSCNRDGVAIVQHGTMKCRIGDTVVQVIAMDNKLGPMPCKPYEITPSEGPVEKTACTFNYTKTLRNKYFEPRDNYFQQYMLKGD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Reference ARO-A13443
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant BVDV (Mucosal disease virus) E2 glycoprotein (Cys1-Asp218).
Product name ARO-A13443-50
Uniprot ID AGC12054.1
Raw Antigen Sequence CDAKPVVKGKFNTTLLNGPAFQMVCPMGWTGSVDCVLANKDTLKVVVVRTYKRARPFPNRQGCVTQKLLGEDLYDCTHGGNWTCIAGEQLHYTGGDIESCKWCGHKFLKSEGLPHYPIGKCRLKNETGYRLVDDTSCNRDGVAIVQHGTMKCRIGDTVVQVIAMDNKLGPMPCKPYEITPSEGPVEKTACTFNYTKTLRNKYFEPRDNYFQQYMLKGD
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Reference ARO-A13443
Isotype IgG
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant BVDV (Mucosal disease virus) E2 glycoprotein (Cys1-Asp218).

Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody binds to Recombinant BVDV E2 glycoprotein Protein, N-His in WB Assay

Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody binds to Recombinant BVDV E2 glycoprotein Protein, N-His in WB Assay

Recombinant BVDV E2 glycoprotein Protein, N-His(cat. No.ARO-P10825) can bind Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody

There are no reviews yet.

Be the first to review “Anti-BVDV (Mucosal disease virus) E2 glycoprotein Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products